KEGG   Pantoea ananatis AJ13355: PAJ_2910Help
Entry
PAJ_2910          CDS       T01969                                 

Gene name
ycjM
Definition
putative sucrose phosphorylase YcjM
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:paj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3482572..3484257
Genome map
AA seq 561 aa AA seqDB search
MEKITALIDKIYADAFPQAMRERLLATIVEARDTTKLPRKAHWDEQDVVLITYADQFREP
GKPTLNTFSRFYQQHLHATFPLVHLLPFYPYSSDDGFSVINYHQVDPLCGDWQNIALLHQ
ETRLMFDFVCNHMSAHSAWFKHYLAQDEGWDDFFISLPPTTDLSAVTRPRTSPLLTPFTL
ENGEIRFVWTTFSADQIDLNFARPRVLVRMVEVLLDYLKRGADYVRLDAVGYMWKTPGTN
CIHLEKTHLLVKLFRAIADVVAPGTVIITETNVPHKDNISYFGNGQDEAQMVYQFSLPPL
VLHAIHTGSARALRQWASTLQVGNGNTTFFNFLASHDGIGLNPARGILSEVEITALVRDL
ALEGALISYKNNPDGSTSPYEINVTYFDALNREGDDDETRLKRFMLAHAILLAFPGVPAV
YIQSILGSRNDYDGVREAGHNRAINRQKYSLSAIEDALVNSDGLRHQVYTRLSKLIQQRR
RQTAFHPDNPLTLFQSDNALLIMKRYSHNGGDELLCVFNLSGRQIEAPLPEAHLFQDVVS
GEKIDGTQPVTLDAWQFMWLR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatcactgctttaatcgataagatttatgccgatgcctttcctcaggctatg
cgcgaacgcctgctcgccacgatcgttgaagcccgtgacaccactaagctgccgagaaag
gcccactgggatgagcaggacgtggtgctgattacgtatgccgatcagttccgcgagccg
ggcaaacccacactcaacaccttttcacgtttctaccagcagcatttgcacgccacgttt
ccgctggtgcacctcctgccgttttatccctattcgtctgacgatggcttttcggtcatt
aactaccatcaggtcgatccactgtgtggcgactggcagaacattgccttactgcatcag
gaaacgcgcctgatgttcgactttgtctgtaaccatatgtcagcgcatagtgcgtggttt
aaacattatcttgctcaggatgaaggctgggatgatttttttatcagcctgccgcccacc
accgacctcagcgcggtcacacggccaagaacgtcaccgttgctcaccccatttacgctg
gaaaacggtgaaatccgctttgtctggaccacgttcagtgccgatcagattgaccttaac
tttgcccgtcccagggtgctggtgcgcatggtagaggtactactcgactatctgaaacgt
ggcgcggactatgtgcgactggatgcggtgggatacatgtggaaaacgccgggcacgaac
tgtattcacctcgaaaaaacgcatctgctggtcaaactgtttcgcgccattgccgacgtg
gtcgcacccggcaccgtcatcatcaccgaaacgaatgtgccgcacaaagacaacatcagc
tactttggtaacgggcaagacgaagcccagatggtgtatcagttttccctgccgccgctg
gtgctacatgccatccacacaggatcggctcgcgctctgcgtcaatgggccagcaccctg
caggtgggcaatggcaatacaaccttttttaacttcctggcctcgcacgatggtataggt
cttaatccggcacgcgggattttatcggaggtggagatcacggcgctggtgcgcgatctg
gcactggagggggcgctgatctcttataaaaacaatcctgacggcagcaccagcccatac
gaaatcaacgtgacctatttcgacgcgcttaaccgtgaaggcgatgacgacgaaacgcgc
ctcaaacgctttatgctggcgcatgctattttactggcctttccgggtgttccagccgtc
tatattcaaagcatcctgggatcgcgtaatgactatgacggcgtacgggaggcaggccat
aaccgggccattaaccggcaaaaatattcgctctccgctatcgaagacgcactggtgaac
agcgacggcttacgccatcaggtttatacccggctgagcaaactgattcagcagcgtcga
cgccagacggcctttcatcccgacaacccgttgacgttgtttcagagcgataatgccctg
ctcatcatgaagcgttattcgcataacggcggtgatgaattactgtgtgtgtttaatctc
agtggcaggcagattgaagccccgttaccggaggcgcatctttttcaggatgtggtaagc
ggtgagaaaattgatggcacccagccagtaacgctggatgcctggcaattcatgtggcta
cgataa

DBGET integrated database retrieval system