KEGG   Pantoea ananatis AJ13355: PAJ_3084Help
Entry
PAJ_3084          CDS       T01969                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00010  Glycolysis / Gluconeogenesis
paj00051  Fructose and mannose metabolism
paj00562  Inositol phosphate metabolism
paj01100  Metabolic pathways
paj01110  Biosynthesis of secondary metabolites
paj01120  Microbial metabolism in diverse environments
paj01130  Biosynthesis of antibiotics
paj01200  Carbon metabolism
paj01230  Biosynthesis of amino acids
Module
paj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
paj_M00002  Glycolysis, core module involving three-carbon compounds
paj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAJ_3084 (tpiA)
   00051 Fructose and mannose metabolism
    PAJ_3084 (tpiA)
   00562 Inositol phosphate metabolism
    PAJ_3084 (tpiA)
Enzymes [BR:paj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAJ_3084 (tpiA)
Exosome [BR:paj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAJ_3084 (tpiA)
  Exosomal proteins of bladder cancer cells
   PAJ_3084 (tpiA)
  Exosomal proteins of melanoma cells
   PAJ_3084 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAK13164
UniProt: A0A0H3L1L6
Position
3695739..3696506
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKHMTAELIDGLRKELSGVEGCGVAIAPPALYLDQAKHAISGSHIA
LGAQNVDVNLSGAFTGEVSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKYAVLKTAG
LVPVLCIGETEAENEAGKTEEVCARQLDAVLTTQGAEAFKDAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKKDAAIAEQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKQR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccactggttatgggtaactggaagttgaatggcagcaagcatatgacagcc
gaactgatcgacggtctgcgcaaagaactgtcgggcgttgagggttgtggcgtcgctatt
gcaccgcccgcgctctatcttgatcaggctaaacacgccatttccggtagccacatcgct
ctgggtgctcaaaacgttgatgtaaacctctctggcgcatttaccggcgaagtgtccgct
gaaatgctgaaagatatcggcgcgaaatacatcatcattggtcactcagaacgtcgcact
tatcacaaagagagtgacgagttcattgcgaaaaaatatgccgtgttgaaaaccgctggc
ctggtgccggttctgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaaccgaa
gaagtatgtgcacgccagcttgatgcggtgctgaccacgcagggtgcagaagcgtttaaa
gacgcggtcatcgcttacgagccggtatgggcgatcggtaccgggaagtcagccacacct
gctcaggcgcaggcagttcacaaatttattcgtgaccacattgccaaaaaagatgcggct
atcgctgagcaagtgattattcagtacggcggctcagttaacgataaaaacgctgccgag
ctgtttactcagccagacatcgacggtgccctggttggcggcgcgtcgctgaaagccgat
gcgtttgccgtgatcgttaaagctgctgcggcggctaaacaacgctaa

DBGET integrated database retrieval system