KEGG   Pantoea ananatis AJ13355: PAJ_3084Help
Entry
PAJ_3084          CDS       T01969                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAJ_3084 (tpiA)
   01230 Biosynthesis of amino acids
    PAJ_3084 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAJ_3084 (tpiA)
   00051 Fructose and mannose metabolism
    PAJ_3084 (tpiA)
   00562 Inositol phosphate metabolism
    PAJ_3084 (tpiA)
Enzymes [BR:paj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAJ_3084 (tpiA)
Exosome [BR:paj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAJ_3084 (tpiA)
  Exosomal proteins of bladder cancer cells
   PAJ_3084 (tpiA)
  Exosomal proteins of melanoma cells
   PAJ_3084 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3695740..3696507
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKHMTAELIDGLRKELSGVEGCGVAIAPPALYLDQAKHAISGSHIA
LGAQNVDVNLSGAFTGEVSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKYAVLKTAG
LVPVLCIGETEAENEAGKTEEVCARQLDAVLTTQGAEAFKDAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKKDAAIAEQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKQR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccactggttatgggtaactggaagttgaatggcagcaagcatatgacagcc
gaactgatcgacggtctgcgcaaagaactgtcgggcgttgagggttgtggcgtcgctatt
gcaccgcccgcgctctatcttgatcaggctaaacacgccatttccggtagccacatcgct
ctgggtgctcaaaacgttgatgtaaacctctctggcgcatttaccggcgaagtgtccgct
gaaatgctgaaagatatcggcgcgaaatacatcatcattggtcactcagaacgtcgcact
tatcacaaagagagtgacgagttcattgcgaaaaaatatgccgtgttgaaaaccgctggc
ctggtgccggttctgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaaccgaa
gaagtatgtgcacgccagcttgatgcggtgctgaccacgcagggtgcagaagcgtttaaa
gacgcggtcatcgcttacgagccggtatgggcgatcggtaccgggaagtcagccacacct
gctcaggcgcaggcagttcacaaatttattcgtgaccacattgccaaaaaagatgcggct
atcgctgagcaagtgattattcagtacggcggctcagttaacgataaaaacgctgccgag
ctgtttactcagccagacatcgacggtgccctggttggcggcgcgtcgctgaaagccgat
gcgtttgccgtgatcgttaaagctgctgcggcggctaaacaacgctaa

DBGET integrated database retrieval system