KEGG   Pantoea ananatis AJ13355: PAJ_3203Help
Entry
PAJ_3203          CDS       T01969                                 

Gene name
xylA
Definition
xylose isomerase XylA
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:paj00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:paj00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3825498..3826820)
Genome map
AA seq 440 aa AA seqDB search
MHAYFDQLDRVRYEGTKTTNPLAFRHYNPDEVIMGKTMAEHLRFAACYWHTFCWNGADMF
GAGAFDRPWQKAGEALDLAKLKADVAFEFFHKLNVPYYCFHDVDVSPEGDSLKSYRENLA
VMTDKLLEKQQETGLKLLWGTANCFTHPRYGAGAATSPDPEVFSWAASQVCSAMKATQTL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNVEANHATLAGHAFHHEIATAIALGVFGSVDANRG
DPQCGWDTDQFPVSVEENALVMYEIIKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKVAARMLSDGELDKRVAQRYSGWNGEFGQQILKGEFSLDALAAHAHQQQFNPQ
HNSGRQEQLENLVNHYLYDF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcttattttgaccagcttgatcgcgttcgctacgaaggaacaaaaaccaccaat
cctctggcgttccgccactacaatccggatgaagtgatcatggggaaaaccatggccgag
catctgcgcttcgccgcctgttactggcatacgttctgctggaacggtgccgatatgttt
ggcgcgggtgcgtttgatcgtccgtggcagaaagcgggcgaggcgctggatctggccaaa
ctcaaagcggacgtggcgtttgagttttttcacaagctgaacgtgccctattactgcttc
cacgatgtggacgtgtcaccggaaggggattcgctgaaaagctatcgcgaaaacctggcc
gtcatgaccgataaactgctggaaaagcagcaggaaaccgggcttaagctgctgtggggc
acagcgaactgcttcacccatccgcgttatggtgcaggcgctgcaaccagtcccgatccg
gaggtgttttcctgggcagccagccaggtatgcagtgccatgaaagccacccagacgctg
ggcggcgaaaactatgtgctgtggggcggtcgcgaaggatacgaaaccctgttaaatacc
gacctgcgccaggagcgcgagcagatcggccgctttatgcaaatggtggtggagcacaag
cacaaaatcggcttccagggcacgctgctgatcgaacctaagccgcaggaacccaccaag
catcagtatgattatgatgtcgccacggtttatggcttcctgaagcagtttggtctggaa
aaagagattaaggtgaacgtcgaagcgaaccatgcgacgctggccggccacgctttccat
catgaaattgcaacggccattgcccttggcgtgtttggttcggtggatgctaaccgtggt
gatccgcagtgcggctgggatacggaccagttcccggtcagcgtggaagaaaacgcattg
gtgatgtacgaaatcatcaaagcaggcggtttcacgaccggcggcctaaactttgatgcc
aaagtgcgccgtcagagcaccgataagtatgacctgttctatggtcatattggcgcgatg
gataccatggcactggcgttgaaagtcgcggcgcgcatgctgtctgacggtgagctggat
aaacgcgttgcgcagcgctacagcggctggaacggtgagttcggccagcagattttgaaa
ggcgagttctctctggacgcgctggcggcccatgcgcatcagcagcagtttaacccgcag
cacaacagtggacgtcaggagcagctggaaaacctggtgaatcactatctctatgatttt
taa

DBGET integrated database retrieval system