KEGG   Pantoea ananatis AJ13355: PAJ_3223Help
Entry
PAJ_3223          CDS       T01969                                 

Gene name
bglA
Definition
beta-glucosidase A BglA
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:paj00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3851685..3853067)
Genome map
AA seq 460 aa AA seqDB search
MNYRFPENFWWGSASSALQAEGDSLNGGKSPTTWDRWFAQQPHRFHQGIGPQDTSGFYQH
WQHDIALLKQLGHNSFRTSLSWARLMPDGTDAVNPDAVAFYNKVIDALLAQGITPFITLF
HFDMPLAMQDKGGWENREVVEAFGRYAQRCFALFGHKVKHWFTFNEPIVPVEGGYLYDFH
YPNVVDFRRAANVALHTVLAHALAVRAWRNGGYDGDIGVVLNLTPSYSRSANPADVQAAH
HADLLFNRSFLDPVLKGEYPVDLLSLLSQYHQLPRCQPGDAALIADGIIDLLGVNYYQPR
RVKCRDSAVNAEAPFMPEWLFDHYEMPGRQMNPYRGWEIYAPGIYDILTNLRVNYGNPRC
FISENGMGVENEQRFIQNGEILDDYRIEFVSEHLKWLHKGIREGCHCLGYHMWTFIDNWS
WLNGYKNRYGFVQLDLATQKRTIKKSGKWFAEVAENNGFN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccgttttcctgaaaatttctggtggggcagcgccagctcggcgttacaagcc
gaaggggacagcctgaatggcggtaaaagccctaccacctgggatcgctggtttgcgcaa
cagcctcaccgtttccatcaaggcattggcccacaagacacctcgggcttttatcagcac
tggcagcacgatatcgcattactaaagcagttagggcacaacagctttcgcacgtcgctg
agctgggcgcgcctgatgccagacggcactgacgccgtgaatcctgacgccgtggctttt
tataacaaggtcatcgatgcattactggcgcagggcattacaccgtttatcaccctgttt
catttcgatatgcctctggctatgcaggacaaaggcggctgggagaaccgtgaggttgtg
gaggcgtttggccgctatgcccagcgctgtttcgcgctgttcggccataaggtgaaacac
tggtttaccttcaatgaaccgattgtgccggtcgaaggtggctatctgtacgattttcat
tatcccaacgtcgtggacttcagacgagcggctaacgtggccttgcacacagtcctggca
cacgcgctggcagtacgcgcctggcgtaacggcggctacgacggtgacattggtgtggtg
ctgaacctcacgccgtcctattcacgatcggcgaatccggccgatgtgcaagccgcacat
catgctgacctgttgtttaaccgtagctttctggatccggttctgaagggagaatatccc
gtggatctgctgagcttactgagtcagtaccaccagcttccgcgctgccagcctggcgac
gctgcgttgattgccgacggcattatcgaccttctgggcgtgaactattatcagccgcgc
cgggtgaagtgtcgggacagcgccgtcaatgctgaagcgccctttatgccggagtggtta
ttcgaccactatgaaatgccaggccgtcagatgaatccgtatcgtggatgggaaatttac
gcgcccggtatttacgatattctgactaacctgcgggttaattatggaaacccgcgctgt
tttatttctgaaaatggtatgggcgttgagaatgaacagcgatttattcagaacggtgaa
attctggatgattatcgtatcgaatttgtttccgaacatcttaaatggctgcataaaggg
attcgcgaaggctgtcattgcctgggttatcatatgtggacatttattgataactggtca
tggctaaacggttataaaaatcgttacggttttgtgcagttagatttagccacgcaaaaa
cgtacgattaaaaagagtggcaaatggtttgctgaggttgccgaaaataacggttttaat
tga

DBGET integrated database retrieval system