KEGG   Pantoea ananatis AJ13355: PAJ_3292Help
Entry
PAJ_3292          CDS       T01969                                 

Gene name
celY
Definition
(GenBank) minor endoglucanase Y precursor CelY
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
paj  Pantoea ananatis AJ13355
Brite
Enzymes [BR:paj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PAJ_3292 (celY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3934447..3935451
Genome map
AA seq 334 aa AA seqDB search
MRVKPVWSGILVLFMMFFSTQAMASGWDTYKSRFLQSDGRIIDTANYNVSHTEGQGYGML
LAVAYNDRATFDKLWKWTRTNLRNPQNDLFYWRYIPDAQDPVADKNNASDGDVLIAWALQ
RAAQKWNASDYQQESDRIQRAIVKLDVTNFGGYTVMMPGAQGFNKNSYVVLNPSYFLFVA
WQEFGQRSHLQVWNKLIDGGMALLGKMHFGNSDLPLDWVALNADGSVAPAVGYSNRFSYD
AIRVPLNIWWYDPQSLALGPFQRLWQGYGRMNTPAWFDVLANTAAPYHLEGGLLAVRDLV
LNETGYLSDKLSPEQNYFSASLQLLTWMAYQEKR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaagccagtgtggtccggtattctggtcttgtttatgatgtttttcagcacc
caggcgatggcaagtggttgggatacctataaaagccgctttcttcagtcagacggacgc
attattgatacggcaaattataatgtcagtcacacggaaggccagggttacggcatgttg
ctggcggttgcttataacgatcgcgcgaccttcgataaactctggaagtggacgcgcacg
aacctgcgcaatccgcaaaacgatctgttctactggcgctacattcctgatgcacaggat
cctgtcgcggataaaaataacgcgtccgatggcgatgtgctgattgcatgggcgttgcaa
cgggctgcgcaaaaatggaatgcaagcgattatcagcaggaatcggaccgcattcagcgt
gcgatagtcaaactcgatgtgacgaacttcggtggctacaccgtaatgatgccgggcgcg
cagggattcaataagaacagctatgtggttttgaatccctcttatttcctgtttgtcgcc
tggcaggagttcggccagcgcagccatttgcaggtctggaacaagctgattgacggcggg
atggcgctgctgggcaagatgcattttggcaacagcgatctgccgcttgactgggtcgcg
ctgaacgccgacggctccgtcgcgcccgcggtgggttattcaaatcgctttagttacgat
gccatccgcgtgccgctgaatatctggtggtacgatccgcaaagcctggcgctggggcct
ttccagcgactctggcagggctatggtcgtatgaatacgccggcctggtttgatgtgctg
gccaatacggcggcgccttaccatctggaaggcggcttgctggcggtacgtgatttggtg
ctcaacgaaacaggctacctgagtgacaaactgtctcctgagcagaactacttttctgcc
agcctgcagttactgacctggatggcttatcaggaaaagcgttga

DBGET integrated database retrieval system