KEGG   Pantoea ananatis AJ13355: PAJ_3321Help
Entry
PAJ_3321          CDS       T01969                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase HemD
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:paj00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3970985..3971713)
Genome map
AA seq 242 aa AA seqDB search
MTILVTRPEPAAAELVSRLHAQGKQAWSLPLIEFAPGNDLLQLPATLATLKRGDLVFLLS
QQVIHFAQHAIKAWPADVDYYAIGRSTALAFHTISGLQVTYPHAHETSEELIKLATLQQI
AGKHALILRGNQGRELLSETLVARGAQVTYAECYQRCQKHYDGAIEGRRWRDRNIHTLVV
TSGEMLHQLYSLFPEVDREEWLLRCRLVVVSERLASLAADLGWQTIQVADGADNDALLRA
LC
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctggtgacgcgcccggaacccgcagcggcggagctggtctcgcgcctgcac
gcccagggtaaacaggcgtggagcctgccgctgatagaattcgcgccgggtaacgatctc
ctgcagttaccggccacccttgccacgttgaaacgcggcgatctcgttttcctcctttcg
cagcaggttattcactttgcacagcacgccatcaaagcatggcccgctgacgtagactat
tatgcaattggtcgcagcaccgctttggcttttcatacgatcagcggcctgcaggtgacc
taccctcacgcgcatgaaaccagcgaagagttgataaaactggcgacattgcagcaaata
gcgggtaagcatgcgcttatccttcgagggaatcagggccgcgagctgctgtcagaaacg
ctggtggcacgtggcgcgcaggtcacctatgcagagtgctatcaacgttgccaaaaacac
tatgacggcgccatcgaaggccgtcgctggcgcgatcgtaatattcacacgctggtcgtg
accagcggtgagatgctgcatcagctgtattcgctgttccccgaggtcgatcgtgaggaa
tggctgctccgctgtcgactagtcgtcgtcagcgaacgtttggcttccctggccgccgat
cttggttggcagactattcaggtagccgatggtgccgataacgatgcgctgttgcgcgcg
ttatgttga

DBGET integrated database retrieval system