KEGG   Pantoea ananatis AJ13355: PAJ_3336Help
Entry
PAJ_3336          CDS       T01969                                 

Gene name
pldA
Definition
phospholipase A1 precursor PldA
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:paj00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:paj00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:paj00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:paj00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3986389..3987132
Genome map
AA seq 247 aa AA seqDB search
MSCFLQHPFAFMNTQFPLENPMRKHRALLAAMLLPALAQADEATIKHVHDAPQVRGSIIA
NLLEQHDNPFVLYPYENNYLLYTYTSDINKEAISSYNWAQNARKDEVKFQLSLAFPLWRG
ILGDNSVLAASYTQRSWWQLSNKKESSPFRETNYEPQIFLGWATDYSFAGWTLRDVEVGV
NHQSNGRSDPTSRSWNRVYTRLMAQNGNFLAEIKPWFRISESASTDDNPGYYKIHGLLPG
ESGLCDG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgctttttacaacacccattcgcttttatgaatacgcagtttccattggagaat
cctatgcgtaagcatcgcgccttgctggcggcaatgttacttcctgctttggcgcaggcg
gacgaagccacgatcaaacacgttcacgatgcaccccaggttcgtggcagcattattgcc
aacctgctggagcagcatgacaacccgtttgtgctttatccttacgaaaataactatctg
ctttacacgtacactagcgacattaataaagaggcgatttcctcttataactgggcgcag
aatgcccgtaaggacgaagtgaaattccagcttagtctggcatttccactgtggcgcggc
atcctgggtgacaactccgtgttagccgcgtcctatactcagcgctcatggtggcagcta
tccaataaaaaagagtcgtcgcccttccgcgagacaaactatgagccgcagattttcctg
ggctgggcgaccgattattcgtttgccggctggacgctacgtgatgttgaagtgggcgtg
aatcatcagtccaatggccgtagcgatcccacgtcacgcagctggaaccgtgtgtatacc
cgcctgatggcgcaaaacggtaatttcctcgcagagatcaaaccctggttccgtatttct
gagagcgccagcacggacgataaccccggatattacaaaatacatgggctactaccgggc
gaaagtgggctatgcgatgggtga

DBGET integrated database retrieval system