KEGG   Pantoea ananatis AJ13355: PAJ_3340Help
Entry
PAJ_3340          CDS       T01969                                 

Gene name
pldB
Definition
lysophospholipase L2 PldB
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PAJ_3340 (pldB)
Enzymes [BR:paj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PAJ_3340 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3990629..3991621
Genome map
AA seq 330 aa AA seqDB search
MKQHRASWLQREKAFAAFATGPLLDFWHSREECEFTGVENLTLRYVRFISPQHKRVIVIV
PGRIESYVKYPELAYDLFHCGFDVIVLDHRGQGRSDRLLDDSHLGHVVEFSHYVDDLETL
YLKEIVSRHYQQRYALAHSMGGAILALFLARQPGAFHAAALVAPMFGIALPLPSFLAHKI
LDWAEKRPAVRDGYALGTGRWRAHPFGINRLTHSHERYRRSLRFYADDPAIRVGGPTYHW
VREGIHAGRNIFSQVDKITTPLLLLQASEDSVVDNRSQDLFCAAMAAAGHPCEGDKPQVI
KGARHEILFEKDSMRAEALNGIVDFFLSHH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacacagagcaagctggctgcaacgcgaaaaggccttcgctgccttcgcgacc
ggcccactgcttgatttctggcacagccgtgaagagtgtgaatttaccggtgttgaaaat
ctgaccttacgttacgttcggttcatttcaccgcaacacaagcgcgtgattgtaatcgtt
cccgggcgcattgagagctacgttaaatatcccgagctggcctacgatctgtttcactgt
gggttcgatgtgatcgtgctcgatcaccgtggtcaggggcgatccgatcggctgctggat
gattcgcatcttggacatgtggtggagttttcccactatgtcgatgaccttgaaacgctc
tatctgaaagagattgtgagccgtcattatcaacaacgttatgcgttggcgcattcaatg
gggggcgcaattctggccctgttcctggcgcgtcagcctggcgcgtttcacgctgcggct
ctggttgcgccgatgtttggcatcgcgctgccgttaccctcttttctggcgcataagatc
ctcgactgggcagagaaacgacctgccgttcgcgatggctatgcattaggcacggggcgc
tggcgggctcatccctttggcattaaccgtctgacgcacagtcatgaacgttatcgtcgc
agcctgcgtttttatgcggacgacccggcgattcgtgttggcggtcccacctatcactgg
gtacgggaaggcattcatgccggacgcaacatattcagtcaggttgataagataacgacg
ccgctattgctgcttcaggcaagcgaagacagcgtggtggataaccgctcacaagatctg
ttttgcgccgccatggcggcagccggtcatccctgtgagggcgataagccccaggttatt
aaaggtgcacgccacgagattctgtttgaaaaagacagcatgcgcgccgaagcattgaat
gggatcgtcgatttctttttatcgcatcactag

DBGET integrated database retrieval system