KEGG   Pantoea ananatis AJ13355: PAJ_3340Help
Entry
PAJ_3340          CDS       T01969                                 

Gene name
pldB
Definition
lysophospholipase L2 PldB
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:paj00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3990629..3991621
Genome map
AA seq 330 aa AA seqDB search
MKQHRASWLQREKAFAAFATGPLLDFWHSREECEFTGVENLTLRYVRFISPQHKRVIVIV
PGRIESYVKYPELAYDLFHCGFDVIVLDHRGQGRSDRLLDDSHLGHVVEFSHYVDDLETL
YLKEIVSRHYQQRYALAHSMGGAILALFLARQPGAFHAAALVAPMFGIALPLPSFLAHKI
LDWAEKRPAVRDGYALGTGRWRAHPFGINRLTHSHERYRRSLRFYADDPAIRVGGPTYHW
VREGIHAGRNIFSQVDKITTPLLLLQASEDSVVDNRSQDLFCAAMAAAGHPCEGDKPQVI
KGARHEILFEKDSMRAEALNGIVDFFLSHH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacacagagcaagctggctgcaacgcgaaaaggccttcgctgccttcgcgacc
ggcccactgcttgatttctggcacagccgtgaagagtgtgaatttaccggtgttgaaaat
ctgaccttacgttacgttcggttcatttcaccgcaacacaagcgcgtgattgtaatcgtt
cccgggcgcattgagagctacgttaaatatcccgagctggcctacgatctgtttcactgt
gggttcgatgtgatcgtgctcgatcaccgtggtcaggggcgatccgatcggctgctggat
gattcgcatcttggacatgtggtggagttttcccactatgtcgatgaccttgaaacgctc
tatctgaaagagattgtgagccgtcattatcaacaacgttatgcgttggcgcattcaatg
gggggcgcaattctggccctgttcctggcgcgtcagcctggcgcgtttcacgctgcggct
ctggttgcgccgatgtttggcatcgcgctgccgttaccctcttttctggcgcataagatc
ctcgactgggcagagaaacgacctgccgttcgcgatggctatgcattaggcacggggcgc
tggcgggctcatccctttggcattaaccgtctgacgcacagtcatgaacgttatcgtcgc
agcctgcgtttttatgcggacgacccggcgattcgtgttggcggtcccacctatcactgg
gtacgggaaggcattcatgccggacgcaacatattcagtcaggttgataagataacgacg
ccgctattgctgcttcaggcaagcgaagacagcgtggtggataaccgctcacaagatctg
ttttgcgccgccatggcggcagccggtcatccctgtgagggcgataagccccaggttatt
aaaggtgcacgccacgagattctgtttgaaaaagacagcatgcgcgccgaagcattgaat
gggatcgtcgatttctttttatcgcatcactag

DBGET integrated database retrieval system