KEGG   Pantoea ananatis AJ13355: PAJ_3361Help
Entry
PAJ_3361          CDS       T01969                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
paj  Pantoea ananatis AJ13355
Pathway
paj00071  Fatty acid degradation
paj00280  Valine, leucine and isoleucine degradation
paj00281  Geraniol degradation
paj00310  Lysine degradation
paj00362  Benzoate degradation
paj00380  Tryptophan metabolism
paj00410  beta-Alanine metabolism
paj00640  Propanoate metabolism
paj00650  Butanoate metabolism
paj00903  Limonene and pinene degradation
paj00930  Caprolactam degradation
paj01040  Biosynthesis of unsaturated fatty acids
paj01100  Metabolic pathways
paj01110  Biosynthesis of secondary metabolites
paj01120  Microbial metabolism in diverse environments
paj01130  Biosynthesis of antibiotics
paj01200  Carbon metabolism
paj01212  Fatty acid metabolism
Module
paj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PAJ_3361 (fadB)
   00650 Butanoate metabolism
    PAJ_3361 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    PAJ_3361 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    PAJ_3361 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAJ_3361 (fadB)
   00310 Lysine degradation
    PAJ_3361 (fadB)
   00380 Tryptophan metabolism
    PAJ_3361 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAJ_3361 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PAJ_3361 (fadB)
   00281 Geraniol degradation
    PAJ_3361 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PAJ_3361 (fadB)
   00930 Caprolactam degradation
    PAJ_3361 (fadB)
Enzymes [BR:paj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PAJ_3361 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PAJ_3361 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PAJ_3361 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PAJ_3361 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: BAK13441
UniProt: A0A0H3L271
Position
complement(4012707..4014890)
Genome map
AA seq 727 aa AA seqDB search
MLYQGANLTLNQLDDGIVELVFDAPGSVNKLDTQTVASLGEAIAVLEQHADLRGVLLSSA
KPAFIVGADITEFLALFDAPTEKLSQWLTFANSIFNRLEDLPVPTIAAIDGYALGGGCEC
VLATDLRVATPTARLGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDIDGMAALR
LGLVDAVVSPDKLRDAALTMLKAAASDGSWRARRAPKLAPLKLSPVEAAMSFTIAKGMVM
QTAGKHYPAPLTAVKTIEAAAALGRDDALKLETAAFVPLAQSDVARALVGIFLNDQYIKG
LAKKRSSENGAPKQAAVLGAGIMGGGISYQSAWKGVPVKMKDIHPQALTLGMNEASKLLN
KQLERGKIDGNRLAAVIATIQPTLDYAGFDQADVVVEAVVENPQIKASVLAETEKHMRSD
AILASNTSTIPISQLAQALQRPENFCGMHFFNPVPRMPLVEVVRGEKTSEATLGKVVAWA
SKMGKTPVVVNDCPGFFVNRVLFPYFAAFGMLLRDGADFRQIDKVMEKQFGWPMGPSWLL
DVVGIDTAHHAQSVMADGFPQRMKKDYRDAIDILFEAKRFGQKNGKGFWRWEEDKKGKPK
KVSDPEVDALLEPACQPKRIFSDEEILNRMMLPMLNEVVRCLEEKIIASPAEADMALVYG
LGFPPFRGGAFRYLDTLGNSNVVDQAKRYTALGGLYELPALLSEKARQHESWYPAVKPID
EAAFRSA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgctaacctcactcttaatcagttggacgacggcattgtcgagctg
gtgtttgatgcccccggctccgttaataagctggatacacaaaccgttgccagcctcggc
gaagcgattgctgtgctggagcaacacgccgatctgcgcggcgtgcttctgagctcagct
aaacccgcctttatcgttggggctgacatcaccgaattccttgcgctttttgacgcgcca
acggaaaagctgagccagtggctgacgttcgcaaacagcatttttaatcgtctggaagat
ttacccgttcccaccatcgccgcgatcgatggctacgcgctgggcggtggctgtgaatgt
gttctggcgacggacttacgggttgccacgccaaccgcccgcctgggcttacctgaaacc
aagctgggcatcatgccgggttttggcggcagcgttcgcctgcctcgcctgttgggtgct
gacagcgcgctggaaatcattgcggcaggtaaagatattgatggtatggctgcgctcagg
ctgggtctggtcgatgcagttgtcagccctgataaactgcgcgatgcagcgctgacgatg
cttaaagcggcagccagtgatggcagttggcgggcacgtcgcgcccctaaattagccccg
ttaaagctgagccctgtcgaggccgcaatgagctttacaatcgctaaaggcatggtcatg
caaacggccggaaaacattatcctgcgccgctcaccgccgtgaagacgatcgaggccgca
gccgcattaggacgtgacgatgcgttaaaactggaaacggcggcgtttgttccgttggcg
caatcggatgtggcccgcgcgctcgtcggaattttcctcaacgatcagtacattaaaggg
ctggcaaaaaaacgcagcagcgaaaatggtgcgccgaagcaggctgccgtgctgggcgcc
gggattatgggtggcggcatcagctatcagtcggcgtggaaaggtgtgccggtcaagatg
aaggatattcatccgcaggcgctgaccctgggcatgaacgaagccagtaagcttctgaac
aagcagctggagcgaggtaagatagacgggaataggctggctgccgtcattgccaccatt
caacccacgctggattatgccggatttgatcaggccgatgtcgtggtcgaagccgtggtc
gaaaatccacagatcaaagccagtgtgctggctgaaacagaaaagcatatgcgcagtgat
gccatcctggcctcgaatacctctacgatccccatcagccagctggcgcaggcactgcag
cgtcccgaaaacttttgcggtatgcacttctttaatccggttccccgtatgccgctggta
gaagtggttcgcggagagaaaaccagtgaagcgacgttgggtaaagtcgtggcatgggcc
agcaagatgggcaaaacccctgtcgtggtgaatgactgcccaggcttcttcgtaaaccgt
gttctgttcccttactttgccgcgttcggcatgttgttgcgcgatggtgcggatttccgc
caaatcgataaagtgatggaaaaacagtttggctggccgatgggcccttcctggctgctg
gatgtcgtagggattgataccgcacatcatgcgcaaagcgtgatggcggatggtttccca
cagcgtatgaaaaaggactatcgcgatgctatcgatattctgtttgaagcaaaacgcttt
ggtcagaaaaacggtaaaggcttctggcgttgggaagaagacaaaaaagggaaacctaaa
aaagtctctgatcccgaggtcgatgcgctgcttgaacctgcctgccagcctaagcggatc
ttcagtgatgaagaaatcctgaaccgcatgatgttgccaatgctgaatgaagttgtccgc
tgtctggaagagaagattattgcttcacctgccgaggcagacatggcgctggtgtacggc
ctgggattcccgccattccgtggtggggctttccgttatctcgacacgctggggaacagt
aatgtcgtggatcaggcgaaacgctatacggctctgggcggcctgtatgagctgcctgcc
ctgctgtcagaaaaagcgcgccaacatgaaagctggtaccccgccgtcaaaccgattgat
gaagccgcgttcagaagcgcctga

DBGET integrated database retrieval system