KEGG   Pantoea ananatis AJ13355: PAJ_3393Help
Entry
PAJ_3393          CDS       T01969                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A AceB
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAJ_3393 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAJ_3393 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    PAJ_3393 (aceB)
Enzymes [BR:paj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PAJ_3393 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4066662..4068260
Genome map
AA seq 532 aa AA seqDB search
MTDSVINSELLFSKPFSDAEKQLLTPDAIAFLQELVTRFAPQRERLLAARQVRQKEYDSG
GLPDFDMETVSIRERAWTIRGIPADLQDRRVEITGPPDRKMVINALNANVKVFMADFEDS
LAPCWEKLIDGQQTLREAVAGTLRYTSENGKIYQLRADPAVLMCRVRGLHLSEKHVSWQG
NAIPGGLFDFALYFFHNAEALLAKGSGPYFYLPKTESWQEVAWWRDIFSFAEDRFDLARG
TIKATVLIETLPAVFQMNEILWNLRDHIVGLNCGRWDYIFSYIKTLREHADRILPDRQSV
TMAQPFLDAYSRLLIQTCHRRGAFAMGGMSALIPSKDSARNEWVLQRVTEDKQREANNGH
DGTWIAHPGLADTAMSVFNQVLGERPNQLNILRQDDSPITAEQLLAPCEGDRTEAGMRAN
IRVALQYLEAWISGNGCVPIDGLMEDAATAEIARTSIWQWIRHQKSLLDGQPVTAALFQQ
LLNDELQTLQMHLGDKTFSSGRYEEAARLMAQITTQDELVSFLTLPGYRLLP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacagactcggttatcaacagtgaattacttttcagtaaaccctttagcgatgcggaa
aagcagttgcttactcccgacgccatcgcttttctgcaggaactggtgacgcgttttgca
ccccagcgtgagagattgttagccgcacgtcaggtccggcaaaaagagtacgattccggc
gggttacctgactttgatatggaaacggtttccataagagagcgagcgtggacgatccgt
ggtattccggccgatttacaggatcgtcgcgttgagatcaccggtccgcccgatcgcaaa
atggtgattaacgccttgaatgctaacgtaaaggtgtttatggccgactttgaggactcg
ctggcaccttgctgggaaaaactcattgacggacagcaaaccttacgggaagccgtggcg
ggaacgctgcgctataccagcgagaacggaaaaatctatcagctacgggccgatcctgcg
gtattgatgtgccgggtacgtggactgcatctgtctgaaaaacatgttagctggcagggc
aatgcgattcccggtggtctgttcgattttgctctctacttttttcataacgcggaagcc
ttactggcaaaaggcagtggcccctatttttatctgcctaaaactgagagctggcaggaa
gttgcgtggtggcgggatatctttagctttgccgaggatcgttttgatctggctcgcggc
accataaaagccaccgtattgatcgaaacgctaccggcggtattccagatgaacgagatc
ctgtggaatctgcgggatcatatcgtggggctgaactgcggccgctgggattatattttc
agctatatcaaaacgctgcgcgaacatgccgatcggattctgcccgaccggcagtctgta
accatggctcagccctttctggatgcttactcacgactgctgatccaaacctgccatcgc
cgcggtgcttttgccatgggcggcatgtcagcactgatacccagcaaggacagcgcgcgc
aatgaatgggtgctgcagcgcgtcactgaagataaacagcgtgaagccaacaacggacat
gacggtacctggatagcgcatcccggcctggcagacactgcgatgtcagtcttcaaccag
gtactgggtgaacgccccaatcagctcaacattctgcggcaggatgacagcccgataacg
gcagagcagcttctggcaccttgcgaaggcgatcgaacggaagcgggcatgcgcgccaat
attcgggtggcgttgcagtatctggaagcctggattagcggcaatggctgtgtccccatc
gatggcctgatggaagatgccgcaactgcagaaattgcccggacttcaatctggcaatgg
atccgccatcagaaatctctgctcgatggacagccggtcacggccgcgctcttccagcag
ctgctgaacgatgagctgcaaacgctacagatgcatctgggcgataagacattcagttca
ggtcgttatgaggaagcggcgcgcctgatggcgcagatcacaactcaggacgaactggtt
tcctttctgactctgccaggctaccgcctgcttccctga

DBGET integrated database retrieval system