KEGG   Pantoea ananatis AJ13355: PAJ_3393Help
Entry
PAJ_3393          CDS       T01969                                 

Gene name
aceB
Definition
malate synthase A AceB
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAJ_3393 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAJ_3393 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    PAJ_3393 (aceB)
Enzymes [BR:paj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PAJ_3393 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4066662..4068260
Genome map
AA seq 532 aa AA seqDB search
MTDSVINSELLFSKPFSDAEKQLLTPDAIAFLQELVTRFAPQRERLLAARQVRQKEYDSG
GLPDFDMETVSIRERAWTIRGIPADLQDRRVEITGPPDRKMVINALNANVKVFMADFEDS
LAPCWEKLIDGQQTLREAVAGTLRYTSENGKIYQLRADPAVLMCRVRGLHLSEKHVSWQG
NAIPGGLFDFALYFFHNAEALLAKGSGPYFYLPKTESWQEVAWWRDIFSFAEDRFDLARG
TIKATVLIETLPAVFQMNEILWNLRDHIVGLNCGRWDYIFSYIKTLREHADRILPDRQSV
TMAQPFLDAYSRLLIQTCHRRGAFAMGGMSALIPSKDSARNEWVLQRVTEDKQREANNGH
DGTWIAHPGLADTAMSVFNQVLGERPNQLNILRQDDSPITAEQLLAPCEGDRTEAGMRAN
IRVALQYLEAWISGNGCVPIDGLMEDAATAEIARTSIWQWIRHQKSLLDGQPVTAALFQQ
LLNDELQTLQMHLGDKTFSSGRYEEAARLMAQITTQDELVSFLTLPGYRLLP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacagactcggttatcaacagtgaattacttttcagtaaaccctttagcgatgcggaa
aagcagttgcttactcccgacgccatcgcttttctgcaggaactggtgacgcgttttgca
ccccagcgtgagagattgttagccgcacgtcaggtccggcaaaaagagtacgattccggc
gggttacctgactttgatatggaaacggtttccataagagagcgagcgtggacgatccgt
ggtattccggccgatttacaggatcgtcgcgttgagatcaccggtccgcccgatcgcaaa
atggtgattaacgccttgaatgctaacgtaaaggtgtttatggccgactttgaggactcg
ctggcaccttgctgggaaaaactcattgacggacagcaaaccttacgggaagccgtggcg
ggaacgctgcgctataccagcgagaacggaaaaatctatcagctacgggccgatcctgcg
gtattgatgtgccgggtacgtggactgcatctgtctgaaaaacatgttagctggcagggc
aatgcgattcccggtggtctgttcgattttgctctctacttttttcataacgcggaagcc
ttactggcaaaaggcagtggcccctatttttatctgcctaaaactgagagctggcaggaa
gttgcgtggtggcgggatatctttagctttgccgaggatcgttttgatctggctcgcggc
accataaaagccaccgtattgatcgaaacgctaccggcggtattccagatgaacgagatc
ctgtggaatctgcgggatcatatcgtggggctgaactgcggccgctgggattatattttc
agctatatcaaaacgctgcgcgaacatgccgatcggattctgcccgaccggcagtctgta
accatggctcagccctttctggatgcttactcacgactgctgatccaaacctgccatcgc
cgcggtgcttttgccatgggcggcatgtcagcactgatacccagcaaggacagcgcgcgc
aatgaatgggtgctgcagcgcgtcactgaagataaacagcgtgaagccaacaacggacat
gacggtacctggatagcgcatcccggcctggcagacactgcgatgtcagtcttcaaccag
gtactgggtgaacgccccaatcagctcaacattctgcggcaggatgacagcccgataacg
gcagagcagcttctggcaccttgcgaaggcgatcgaacggaagcgggcatgcgcgccaat
attcgggtggcgttgcagtatctggaagcctggattagcggcaatggctgtgtccccatc
gatggcctgatggaagatgccgcaactgcagaaattgcccggacttcaatctggcaatgg
atccgccatcagaaatctctgctcgatggacagccggtcacggccgcgctcttccagcag
ctgctgaacgatgagctgcaaacgctacagatgcatctgggcgataagacattcagttca
ggtcgttatgaggaagcggcgcgcctgatggcgcagatcacaactcaggacgaactggtt
tcctttctgactctgccaggctaccgcctgcttccctga

DBGET integrated database retrieval system