KEGG   Pantoea ananatis AJ13355: PAJ_3505Help
Entry
PAJ_3505          CDS       T01969                                 

Gene name
iucB
Definition
aerobactin siderophore biosynthesis protein IucB IucB
Orthology
K03896  
acetyl CoA:N6-hydroxylysine acetyl transferase [EC:2.3.1.102]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Lysine degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PAJ_3505 (iucB)
Enzymes [BR:paj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.102  N6-hydroxylysine O-acetyltransferase
     PAJ_3505 (iucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4205904..4206851
Genome map
AA seq 315 aa AA seqDB search
MSQATIVHSGHGLRCEKSGKTLNLGWGQDNSAVLHFAGPLPEGWLRDALDQMFIAAPQLS
AVVLPFAEWREEPQALALFAALKSDIVHRETFWQLPLWLSAPRQQASGEMVFDAEREIYF
PQRPARPDGEVYRRYDPRVRRTLSFRVADPARDAEAFTRWMNDPRVDYFWEQSGSLATQT
AYLERQLGSSYAFPLIGCFDDEPFSYFEIYWAAEDRIGRHYSWQPYDRGLHLLVGEPQWR
GPHFVQSWLRGISHYLLLDNPQTQRLVLEPRADNQRLFRHLEPAGYTSVKEFDFPHKRSR
LVMTQRARFFSEVGL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggcaacgattgttcacagcggccacggcctgcgttgcgaaaagtcaggaaaa
accctgaatctgggttggggacaggacaacagtgcggtgctgcattttgccggtccactg
cccgaaggctggctgcgtgacgcgctggatcagatgtttatcgctgccccgcagctttct
gccgtggtgctgcccttcgcagagtggcgtgaagagcctcaggcgctggcgctgtttgcg
gccctgaaaagcgatatcgtccaccgcgagacgttctggcaactgccgctgtggttgtct
gcgcctcgtcagcaggcctccggcgagatggtatttgatgccgaacgtgagatctatttt
ccccagcgcccagcgcgacctgatggcgaagtgtatcgccgttacgacccgcgcgtacgg
cgaacgctgagcttccgcgtggccgatcctgcccgcgatgccgaagcgtttacccgctgg
atgaacgatccgcgcgtggattacttctgggagcagagcggatcgctggccactcagacc
gcctatcttgaacgccagctcggcagcagctatgcctttccgctgattggctgttttgat
gacgagcccttcagctactttgaaatttactgggcggcggaagatcgtatcgggcggcac
tacagctggcagccgtacgatcgcggtttgcatctgctggtgggtgagccgcagtggcgc
gggccgcactttgtgcagagctggctgcgcggcatcagccactatctgctgctggataat
ccgcaaacccagcgcctggtgctggaaccgcgggcggataatcagcgcctgtttcgtcac
cttgaacccgcgggctataccagcgtgaaagagttcgactttccgcacaagcgctctcgc
ctggtgatgacccagcgcgcccgtttcttcagcgaggtgggcctgtga

DBGET integrated database retrieval system