KEGG   Pantoea ananatis AJ13355: PAJ_3530Help
Entry
PAJ_3530          CDS       T01969                                 

Gene name
cex
Definition
exoglucanase/xylanase precursor Cex
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
paj  Pantoea ananatis AJ13355
Brite
Enzymes [BR:paj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     PAJ_3530 (cex)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4233055..4234308
Genome map
AA seq 417 aa AA seqDB search
MQRIAADGEVVWRYKKAGAGPTWPEYCPLESGGIVALRLTDTVFSSTSTSTSTSPCRRRF
LKSSAALMLAGALPLPVLASIPPFPALKTVAAQSHRLFGFAVGPDSLQSDAHYRQFVASQ
ASIIVPENALKWMAVHPARDRYDFAGPDAIAAFAREQGIRLRGHTFCWHRALPDWVQAIA
DKAELEKVLRQHIATVAGRYRGQIHSWDVANEIINLADGQPGGWRNSFWYQRLGTRYMDI
ACEALHQADPHAVICYNDYGLESDDVSGQRKRAAVLAMLRDLQSRHIPIGALGIQSHLKA
GPHPAFGPGLAAFIRDVKSLGLKVYITELDVDDSSVPMESRPMAVAALYKRYLSLVLEAG
VAAILTWGVWDTPHRTAATPKAGDALATGPLLFGKDGSIKEASWAALHALRSSPDLR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaatcgcggcagacggcgaggtcgtttggcgctataaaaaagcaggggccggg
ccaacgtggccggaatattgcccactggaatccggaggcatcgtggcgctacgtcttacc
gataccgtctttagctcaacctcaacctcaacctcaacctcgccatgccgacgccggttt
ctgaaaagcagcgcggcgctgatgctggcgggcgcgctgccgttgccggttctggcatcc
atcccaccttttcccgcccttaaaaccgttgcggcgcaaagtcatcggctgtttggcttt
gccgtcgggcccgacagtctgcaatccgatgcgcactatcggcagtttgtggcgagtcag
gcgagcattatcgtgccggaaaatgcgctgaaatggatggccgtccatcccgcgcgcgat
cgctacgatttcgccgggcccgatgcgatcgccgcctttgcccgcgagcaggggataagg
cttcgcgggcatacgttttgctggcaccgcgccctgccggactgggtacaggctattgct
gataaggctgagctggagaaagttttgaggcagcatatagcgaccgttgcgggccgctac
cgcgggcagattcacagttgggacgtggcaaacgaaatcatcaatctcgccgacggacaa
cctggtggatggcgcaacagtttctggtatcagcggcttggtacgcgttatatggatatt
gcctgcgaggcgctgcaccaggccgatccccatgcggtcatctgttacaacgattacggg
ctggaaagtgacgatgtgagtgggcaaaggaaacgggcggcggtactggcgatgctgcgc
gacttgcagtccagacatattccgattggcgcgctcggcatccagtctcatctcaaagcc
gggcctcatcccgcctttgggccggggctggcggcatttattcgcgacgtgaaatcgctt
ggcctgaaggtgtacatcaccgaactggacgtggatgacagcagcgtgccgatggagagc
cggccgatggcggttgccgcgctgtataaacgctatctttcactggttctggaggcgggc
gttgccgccattttaacgtggggcgtttgggatacgccgcaccgcacggctgcgacaccg
aaggcgggggacgcgctggcgaccgggccgctgctgtttggtaaagacggcagcattaaa
gaggccagttgggcggcgctgcacgcgctccgctcatcaccggatctcagatga

DBGET integrated database retrieval system