KEGG   Pantoea ananatis AJ13355: PAJ_3623Help
Entry
PAJ_3623          CDS       T01969                                 

Gene name
nahA
Definition
beta-hexosaminidase precursor NahA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:paj00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:paj00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4331287..4333662
Genome map
AA seq 791 aa AA seqDB search
MPLRRNVLICCYALTFSAAADTLPLMPWPQQVEQPAHAGWLTLTPQLTLQIVGDTLPGAE
TRWLSRIARQTGWPLLPADQPVEHPTIRIAIAQAVNPVPQPDSDESYQLDVNRDGVLLKA
NSRFGAMRGMETLLQLIENSAEGTRIPWITIHDKPRFAWRGILIDSARHFMPVRTLKRQI
DGIAAARMNVLHWHLTDDQGWRFASLRYPQLQQKASDGLFYTQAEMREVVQYAAERGVRV
VPELDIPGHASALAVAMPELISAPGPYQMERGWGVFKPLLDPSNEQVYQVIDALVGEMAA
IFPDPYLHIGGDEVDPSQWQASAAVQQFMRDRGLADPHALQAWFNQRVEKILEKHQRRMV
GWDEIAHPDLPHSILIQSWQGQDALGTVAKNGYRGILSTGFYLDQPQPASYHYRNEIYPQ
GLNGQDVVQSGEQAQSWSFTMPRLKGSPVTGSFTLIKGRDGWRGFIDFAGKSRRLVNAID
WLSANRLTFTVDTWMGPFKPVVTLANNQLSGYMLVGNVRYAAEGQRLDAVPRGIQPVLPD
ARQMQQNLLGGEAALWAENVNSAIIDTKLWPRAFVVAERLWSAQDVTDPDSMYQRLAAMD
RWTTVSVGLQQHYQADRQMTRLANSTDIQPLRVLAQALEPAQYYTRQHLKFQAGHYNYFE
PLNRLADVLPAESDAVRTLDKQVVALVEDRSNVAAAAAIRSQLQRWHDNAAQVAPLLNGS
APLKALESSAKQVDELSVMGINMVNAYVRNQAFGASEMAQMHAKLDAAAQVQDETVIALV
RPLEALLRAFK
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgccgttacgtcgaaatgtgctgatctgttgttatgcgctgaccttttccgccgccgcc
gatacgctgccgctcatgccgtggccacagcaggttgagcaacctgcccacgcaggctgg
ctgacgctcaccccacagctgacgctacagattgtcggggacacgctgcccggcgccgaa
acacgctggctgtcgcgcatcgctcgccaaaccggctggccgctgttacccgccgatcag
ccggttgagcatcccacaattcgtattgccatcgcgcaggcggtcaaccctgtccctcag
cctgacagcgatgaaagttaccaactggacgtcaaccgcgacggcgtgctgctgaaagcc
aacagccgctttggcgcgatgcgcggcatggaaacgttactgcaactgatagaaaatagt
gccgaaggcacccgtattccctggatcacaattcacgataaaccgcgctttgcctggcgc
ggcatccttatcgacagcgcccgccattttatgccggtcagaacgctgaaacgccagatc
gatgggatcgcggcggcgcgaatgaacgtgctgcactggcatctcaccgacgatcagggc
tggcgctttgcctccctccgctatccgcaactgcagcagaaagccagcgacgggcttttc
tatactcaggcggagatgcgtgaggtggtgcagtatgcggctgagcgtggcgtgcgcgtg
gtgccggagctggatatacccggccatgcctccgcgctggcggtggcgatgccggaactg
atcagcgcgccggggccgtatcagatggagcgcgggtggggcgttttcaaacccttgctg
gatcccagcaacgaacaggtttatcaggttattgacgcgctggtgggggagatggcagcg
atcttccccgatccctacctgcatatcggtggcgatgaggtggatcccagccagtggcag
gcatccgccgctgttcagcagtttatgcgcgatcgtggattagccgatccccatgcgctg
caggcctggttcaatcagcgcgttgagaaaatcctcgaaaaacaccagcggcgcatggtg
ggctgggatgaaattgcccatcccgatctgccgcacagcattctgattcagtcctggcag
ggacaggatgcactgggcacggtagcgaaaaacggctatcgcggcattctgtccacgggt
ttttatctcgatcagcctcagccggccagctatcactatcgcaacgaaatctatcctcag
ggccttaacggccaggatgtggtgcagtcgggcgaacaggctcagagctggtcctttacc
atgccacggttaaaaggcagcccggtaacggggagtttcaccctgattaaaggccgcgac
ggctggcgcggttttatcgactttgccggaaaatcgcgtcgtctggtgaacgccatcgac
tggctttcggcgaaccggctgacgttcacggtggatacctggatgggaccgttcaaaccg
gtcgtcaccctggcgaacaatcaactgagcggatacatgctggtgggtaacgtccgttac
gcggccgaagggcagcggctcgacgcggtgcccagggggattcagcctgtgctgccggat
gcgcgccagatgcagcaaaacctgctgggcggtgaggccgcgctgtgggccgaaaacgtc
aacagcgcgattattgataccaaactctggccgcgtgcgtttgtggtggcggagcggtta
tggtcagcccaggatgtcaccgatcccgacagcatgtaccagcggctggcggcaatggac
cgctggacgaccgtatcggtggggctgcagcagcattatcaggcagaccgacagatgacg
cggcttgcaaacagcacggatattcagccgctgcgcgtgctggctcaggcgctggaaccg
gcccagtattacactcgacagcatctcaagtttcaggccgggcattacaactactttgag
ccgctgaaccggctggccgatgttttaccggcagaaagcgacgccgtcagaacactggat
aagcaggtggtcgcgctggttgaagacagaagcaacgtggcggctgccgcagctattcgc
tctcaactccaacgctggcacgataacgctgctcaggttgcgccattactcaacggcagc
gcgccacttaaggcgctggaaagcagcgcgaaacaggtggatgagctgagcgtcatgggc
atcaacatggtgaatgcctatgtccgtaaccaggcgtttggggccagcgaaatggcgcag
atgcatgcgaagctggatgcggcggcacaggtgcaggacgaaaccgtcatcgcccttgtc
aggcctcttgaggccctcctccgcgccttcaaatga

DBGET integrated database retrieval system