KEGG   Pantoea ananatis AJ13355: PAJ_3647Help
Entry
PAJ_3647          CDS       T01969                                 

Gene name
argE
Definition
acetylornithine deacetylase ArgE
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:paj01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:paj00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4368740..4369855)
Genome map
AA seq 371 aa AA seqDB search
MALTRTADLALQLIRFDTLNPPGNEAACMMFFAGWLEENGFEVTLSSFGEGRHNLIARLR
GEQAGPALAFTGHLDTVPLGNADWQHDPFGEIVDDRLYGRGSSDMKAAVAAFAVACVTHQ
QAIRQGPGVVLLITGGEETGCDGARALIDTADLPEVGALIVGEPTANYPVIGHKGALWLR
CETRGKTAHGAMPELGINAIYLAADALGKIQHFSPGAPHPLMKQPTINVGRITGGLNINS
VPDRTQFDVDIRSAPNLQHATIRQQLSTLLGESVTISTLVDLPAVLSEGDHAWIQAVYQR
CQPLHDTPLVPRIVPYFTDASLLLPALGNPPCIILGPGEPSMAHQTDEYCLLSRLAEAEA
LYGALICDGVR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcccttacccgcacggcggatctggcgttacagctgatccgctttgataccctcaat
ccaccgggtaacgaagccgcctgcatgatgttttttgccggctggctggaggaaaacggc
ttcgaggtcacgctgtcatccttcggcgaaggacgccataacctgatagcccgcctgcgc
ggcgagcaggccggacctgcgctggcctttaccggccatctggatacggtgccgctcggt
aacgccgactggcaacacgatccctttggcgagatcgtggacgatcggctctatggcagg
ggatcgagcgatatgaaagcggccgttgccgcctttgccgtggcctgcgtcacgcaccag
caggccattcgccaggggccgggcgtggtgctgctgattaccggcggtgaggaaaccggc
tgcgacggcgcgcgggcgctgatcgataccgctgacctgcccgaggtgggcgcgctgatc
gttggcgaacccaccgcgaactatccggttatcggccacaaaggcgcactgtggctgcgc
tgtgaaacacgcggtaaaaccgcgcacggcgcgatgcccgagctgggcatcaatgcgatc
tacctggcggccgatgcgctgggtaaaattcagcatttctcccccggcgcgccgcatccg
ctgatgaaacagcccacgatcaacgtcgggcgcatcacaggcggcctgaatattaactcc
gtgcctgaccgcacgcagtttgacgtggatattcgtagcgcgcccaatcttcagcacgcc
accatccgtcagcagctcagcaccttactgggcgaaagtgtgacgatatctacgctggtg
gacctgccagcagtgctcagtgaaggcgatcacgcatggattcaggcggtttatcaacga
tgccagccattgcatgatacgcccctggtgccgcgcattgtgccctacttcaccgatgcg
tcgctgctgttgcctgcgctgggcaatccgccctgcataattctgggccctggcgagccc
tcaatggcgcaccagaccgatgaatattgcctgctgagcaggttagcggaagccgaggcg
ctgtatggtgcgttgatttgtgacggggtgcgatga

DBGET integrated database retrieval system