KEGG   Pantoea ananatis AJ13355: PAJ_3654Help
Entry
PAJ_3654          CDS       T01969                                 

Gene name
rbsK
Definition
ribokinase RbsK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAJ_3654 (rbsK)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PAJ_3654 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4376144..4377025)
Genome map
AA seq 293 aa AA seqDB search
MRVYVAGNITVDETWSIADIPLKGASVHGNKVSQDIGGKGANQAILLSRCGIETHLIAAT
GKDNNGITLRQQLTLEPLYFMPAEPVHPFSDTSLILNSADGDNAIITSTGAADALSIDII
SAHLAAARAGDVLVQQGNFSPEKTHALFQLAKSRGLITVFNPSPVHAGFSACWPLVDIAV
VNQHEARQLHPEAVKTLVVTHGSAGAWLIQGDRREFCPATPVEALDTTGAGDTFLAVMLA
SALRRQVQIDKLALTHASQAAAITVSRRGTLSAFPSVNELAALLSAGGESGVT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtttatgtggccggaaatatcactgtcgatgaaacctggagcattgccgatatt
ccgttaaaaggcgcatcggttcatggaaataaagtttcgcaggatatcggcggtaaaggc
gcgaatcaggcgattctgttatcccgctgcggcatagaaacccatttaattgccgcgacg
ggcaaagacaacaatggaataactcttcgccagcagctcactctggagccgctttatttt
atgcccgctgaaccggttcatccctttagcgatacctcgcttattctaaacagcgccgac
ggcgacaacgccatcattaccagcaccggggcagccgatgcgttgagcattgatatcatc
agtgcacatctggccgcggcacgcgctggcgatgtcctggtgcagcagggcaacttctcg
ccggagaaaacccatgcgctgttccagctggcgaagtcgcgtggcctgatcaccgtcttt
aacccttcgccggtccatgccgggttcagtgcctgctggccgctggtggatattgccgta
gtgaatcagcacgaagcccggcagttgcatcctgaagcggttaaaacgttagtggttact
cacggtagcgcgggtgcctggctgattcagggcgaccgccgcgagttttgccctgccacg
cccgtcgaggcgctggataccaccggcgcgggcgatacctttcttgccgtcatgctggcg
tcggcactcaggcgccaggtccaaattgataagttagcacttactcatgccagtcaggcc
gccgccatcacggtgagccgtcgcggcacgctgagtgccttcccctccgtcaacgaactc
gccgcactgctgagtgcaggcggcgagtcaggcgttacttaa

DBGET integrated database retrieval system