KEGG   Pantoea ananatis AJ13355: PAJ_3750Help
Entry
PAJ_3750          CDS       T01969                                 

Gene name
holD
Definition
DNA polymerase III psi subunit HolD
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:paj00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:paj00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:paj03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:paj03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:paj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4504492..4504902
Genome map
AA seq 136 aa AA seqDB search
MTSRRDWLLQQMGITQYQLRRPRVLQGEIAVRLLPDTQLIIVAENPPGLQEPILRDVLHT
LSLKPTQVMTVTPDQLQMLPETLNCAGWLLGVESEQTFNGVALTSASFNELLSSGAARRA
LWQQMCEHDSHFFPHA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccaggcgcgactggcttttacagcaaatggggattacgcagtatcaactgcgc
cgcccgcgcgtgctccagggcgagatcgccgtacggcttttgccggatacgcagctgatt
attgtggcggagaatccgccaggtttgcaggaacccatcctgcgtgatgtcctgcacacg
ctcagtcttaaaccgacgcaggtgatgaccgtgacgcctgaccaactgcaaatgctgccg
gaaacgctcaactgcgcgggctggctattgggtgttgagagcgaacaaacctttaatggc
gttgccttaaccagcgcttcttttaatgaactgcttagcagcggtgccgcccggcgcgcg
ctctggcaacagatgtgtgaacatgacagccatttctttcctcacgcctga

DBGET integrated database retrieval system