KEGG   Pantoea ananatis AJ13355: PAJ_3767Help
Entry
PAJ_3767          CDS       T01969                                 

Gene name
rbkS
Definition
ribokinase RbkS
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAJ_3767 (rbkS)
Enzymes [BR:paj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PAJ_3767 (rbkS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4523571..4524488
Genome map
AA seq 305 aa AA seqDB search
MDIAVIGSNMVDLITYTNSFPKAGETLEAPDFAIGCGGKGANQAVAAAKLGGEVMLVSKV
GDDLFAPTTLANLQQQGVDTRYVTTEKGVSSGVAPIFVDDQSQNRILIIKGANQHLKPAD
IDAAGDALKRCRLIILQLEIPLETVYYAIDFARQHDIRVILNPAPAVADLDIRYACQCDF
FMPNETELEILTGMPVGTDDDVRLAGASLLKRGLKNLIVTLGSRGSLWMTGETQHQVAPV
PVKAVDTSGAGDAFIGCFAHELVKTGDIPAAMAKASAYAACSVTARGTQRSYPDTAEFQR
FLDLQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgccgttattggttcaaacatggtggatttaatcacctataccaacagcttt
cctaaagctggagagacgcttgaggcacccgattttgcgattggctgtgggggaaaaggg
gccaatcaggctgtggcggcagcaaaactgggtggcgaggtgatgctggtcagtaaagtc
ggcgatgacctgtttgcgcccaccacgttggctaatttgcaacagcagggcgtggatacg
cgttatgtcacaaccgaaaaaggggtttccagcggcgtggcccccatttttgttgatgat
cagtcgcaaaaccgcattttaattatcaaaggcgcgaatcagcacctcaagccggcggat
attgatgctgcgggtgatgcgttgaaacgctgtcggttgatcattcttcagctcgaaatt
ccgctggaaacggtgtactacgctatcgattttgcccgtcagcatgatattcgcgtcatc
ctcaaccctgcgcccgccgtggcagacctggatatccgctatgcctgccagtgcgacttt
tttatgcccaatgagacggagctggaaattcttaccgggatgccggtggggacggatgat
gacgtcaggctggccggtgcatccttgctgaaacgtggcctgaaaaacctgatcgttacg
ctgggcagtcgcggatcgttgtggatgaccggagagacacagcaccaggttgcgcctgtg
ccggttaaggcagtggataccagcggtgcgggtgatgcgtttatcggctgcttcgctcat
gaactggtgaaaacgggcgatattcctgcggcgatggccaaagcctccgcctacgcggcc
tgtagcgtgacggcgcgcggcacacaacgttcttatcctgatacagcggaatttcagcgc
tttcttgaccttcagtga

DBGET integrated database retrieval system