KEGG   Pantoea ananatis AJ13355: PAJ_p0267Help
Entry
PAJ_p0267         CDS       T01969                                 

Gene name
cga
Definition
glucoamylase precursor Cga
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
paj  Pantoea ananatis AJ13355
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAJ_p0267 (cga)
Enzymes [BR:paj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PAJ_p0267 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pEA320:296955..299414
Genome map
AA seq 819 aa AA seqDB search
MKHDDPPLRAGVDAAPGRPGIEARWTSSAKSGIGTALSSDSRVWFTLSHGVLNEIYYPRV
DSACTRDCVFVITGPEGYFSEEKRDCLTETRTHSPGIPAFTITNTARDGLYRLEKDIITD
PARDCVLQRVRFTALKGNVEDYTVTALLAPHLVNAGQMNAAWIGEFDYKPVLFATGRSRY
LALVCDIPWTAMSAGFVGMSDGWQQLKEQGRLVNQYRRADDGNVALAGELAFTSACSEAT
LAIGFGQTESEAAAAAIASLNAGFDKARDGYIRNWQAWQDRLIPLDQEARNGVNTYRVST
AVLASHRAADCPGAVVASLTIPWGFSKGDDDLGGYHLVWPRDLVETAGGFLAAGDADQAL
AILEYLRRVQEPSGRWPQNLWLDGKPYWPGIQMDECAFPLLLMDMLRRLGYLDNKAQKRF
MPMLRRAACYILTNGPATAEDRWEEDSGYSPFTLAVEIAALLAAADLLSIDGDEAAANHL
RETADCWNEQIEKWTFAGDPHFCTSIGISGHYVRIAPSGATDEVSASGNTEIRNQTPDRA
LLPTADVLSPDALALVRFGLRAADDPHILDTIKAIDHSLRVDLPQGPLWYRYTGDGYGEH
ADGAPFDGIGQGRPWPLLAGERAHYELAAGRHDAAEALLATLEKSAGSGGLLPEQVWDGP
DIPDKALFFGRPSGSAMPLVWAHSEHIKLLRSLRDGAVFDMPPQGVERYIRNQTGSHLRI
WRFNNRVSSLPVGKQLRLETEANALVHWSTDDWATVSDSPARSSGLGTYYVDLPVQHETA
GTRVVFTFYWPDVEHWENTDFTVHVVNEPNDQTRIGNGE
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatgacgacccgccattacgcgcaggcgttgacgccgccccgggaaggccagga
attgaagcccgatggacatcgagtgccaagagcggaatcggcacggccctttcatcagac
tcgcgcgtctggttcacattgagccacggcgttctgaacgaaatctattatccacgcgtt
gacagcgcctgtacccgcgattgcgtcttcgttatcacggggcctgaaggttatttctcc
gaagaaaagcgcgactgcctgaccgaaacccgaacccactcgccaggcattccggccttc
acaatcaccaacacggcgcgtgacggcctctacaggcttgagaaggacatcattacggat
ccggcccgtgactgtgtgctgcagcgggtccgcttcaccgcgttgaaggggaacgttgag
gattacaccgtcaccgcactgctcgctccccatctggtgaatgccggacaaatgaacgcc
gcctggatcggcgaatttgactataagccagtgcttttcgccaccggccgctcccgctat
ctggcgctcgtctgcgacatcccctggacggcaatgagcgccgggtttgtcggtatgtca
gacggctggcagcagcttaaagaacagggacgccttgttaaccaataccggcgggcagac
gatggcaatgtcgcgcttgccggagagctggcgttcaccagcgcctgcagtgaagccacg
ctggctattggtttcggccaaacggaatccgaggccgcagcggcggcaatcgccagtctt
aacgcgggctttgataaagcgcgcgatgggtatattcgcaactggcaagcgtggcaggac
aggctcattccactcgatcaagaagcgcgaaacggcgtcaatacataccgggtttcaacg
gcggtactggcctcgcacagagccgctgattgtcccggcgccgttgtcgcgagcctgacg
ataccctggggattttcgaagggcgatgacgatcttggcggctatcatctggtctggccg
cgagacctggtcgaaacggcaggggggttcctggccgcaggcgacgccgaccaggcactc
gccattctggaatatctccgtcgtgttcaggagccctccgggcgctggccacagaacctg
tggctggatggaaaaccctactggccaggcatccagatggatgagtgtgcattccccctt
ctgcttatggatatgctgcgcagactcggctatctcgacaataaagcgcagaaacgcttt
atgcctatgctacgccgcgcggcctgctacattttgaccaacggcccggcgaccgcggag
gaccgctgggaggaagactcaggctacagtccgtttaccctggcggtcgagatcgctgca
ctgcttgccgccgcggatctgctttcgatagacggagatgaagcggcggcaaaccacctg
cgagaaaccgcagactgctggaatgagcagattgaaaaatggacctttgccggggatccc
catttttgcacctcgattggcatttccggtcactatgtccgcatcgcgccgtcgggcgca
acggatgaggtcagcgcatccggcaataccgagattcgcaaccagacaccggatcgggcg
cttctgccgaccgctgatgtgctgagcccggatgccctggcactggtgcgtttcggcctg
cgtgcagcggacgacccgcacatccttgatacgataaaggctattgaccacagtcttcgg
gtcgatttacctcaggggccattgtggtatcggtacaccggtgatggctatggcgaacac
gcagacggcgcgccgttcgacggtatcggccaggggcgtccatggcctctgctggcgggc
gaacgcgcgcattacgagctggcagcgggcaggcacgacgcggctgaggcgctcctggcc
acgctggaaaaatcggcaggctcgggcgggctgttaccggaacaggtatgggacggcccc
gatattcccgataaggcgctgttcttcgggcgtccttccggtagcgccatgccgcttgtc
tgggcacattccgaacatattaaactgctgcgatcgcttcgcgatggcgcggtcttcgat
atgccaccccaaggcgttgaacgctatatcagaaatcagaccggatcgcatttgcgcata
tggcgctttaacaaccgcgtatcctcccttcctgtcgggaagcaactgaggctggaaacg
gaagcgaacgccctggtgcactggagtacggatgactgggctaccgtttctgactccccg
gcgcgctcatcggggcttggaacctattacgtggacctgcctgtacagcacgaaaccgca
ggaacccgtgttgtctttaccttttactggcctgacgttgaacattgggaaaacaccgat
tttaccgttcacgtcgtaaatgaaccgaacgatcaaacccgcattggcaatggagaatga

DBGET integrated database retrieval system