KEGG   Propionibacterium acnes SK137: HMPREF0675_3016Help
Entry
HMPREF0675_3016   CDS       T01215                                 

Definition
(GenBank) putative ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
pak  Propionibacterium acnes SK137
Pathway
pak00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0675_3016
Enzymes [BR:pak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HMPREF0675_3016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ADD99039
UniProt: D4HEH5
Position
21277..22206
Genome map
AA seq 309 aa AA seqDB search
MSGATAKVTVVGSINADMRVGVERFPGPGETLAGGEATLTTGGKGANQALAAARCGVQVA
MVGAVGKDPTAETALSLLSESVGLDGVVRRDVLTGTAVVMVADSGENSIIVVAAANGTVD
AQTVQAQAERIQDADVVVCQGEIPPDGIAEAARGAKRFVFNLAPVVDVDPEVIRMADPLV
VNEHEAALVALALGSTTSRLEDDPDAALRELLNLGCRSVVITLGSAGCIVGGPEGFDAVA
AATVKAVDTVGAGDAFVGALAAELARGRTLVEGCRFATAVATLTVTKPGAQASYPSADEV
ESIRRGEHA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgcgacagcgaaagtcaccgtcgtcggatcgatcaatgccgacatgagggtc
ggcgtggagagatttccgggcccaggggagaccctggccggaggtgaggcgacactgacc
accggcggtaagggagctaaccaggctcttgcggcggcgcgatgtggcgttcaggtggcg
atggtcggagctgtggggaaggacccgacggctgaaaccgccctatccctactatcggaa
agcgttggccttgatggcgtggtccgtcgtgatgtattgacggggacggccgtcgtcatg
gtcgcggattccggagagaactcgattatcgtcgtcgcggccgctaatgggaccgttgat
gcacagacagtccaagctcaagccgagcgcatccaggacgctgacgtggtggtgtgtcaa
ggtgagattccgcctgacgggattgccgaagctgctcgcggcgccaaacgattcgtgttc
aatctggcaccggttgttgacgttgatccagaggtcattcgcatggccgacccgctggta
gttaacgaacatgaggcggccttggtggctcttgctttgggatcgacgacttctcgtctt
gaggatgatcctgacgcagcgttgcgcgagctgttgaaccttgggtgccgcagtgttgtc
atcaccttggggtcggccggatgcatcgtcggcgggccagaagggttcgacgccgtggct
gcggcgaccgtgaaggctgtcgataccgtcggtgcgggagatgctttcgttggtgcgttg
gctgcagaactggctcgtggccgtactcttgtcgagggttgccgttttgctaccgcggtg
gcgactttgacggtgaccaagccgggggcacaagcctcctaccccagtgctgacgaggtg
gagagcattcgtcgaggagaacacgcatga

DBGET integrated database retrieval system