KEGG   Propionibacterium acnes SK137: HMPREF0675_3066Help
Entry
HMPREF0675_3066   CDS       T01215                                 

Definition
(GenBank) glycosyl hydrolase family 20, catalytic domain protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
pak  Propionibacterium acnes SK137
Pathway
pak00511  Other glycan degradation
pak00520  Amino sugar and nucleotide sugar metabolism
pak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0675_3066
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF0675_3066
Enzymes [BR:pak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HMPREF0675_3066
Chaperones and folding catalysts [BR:pak03110]
 Intramolecular chaperones
  Others
   HMPREF0675_3066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: ADD99673
UniProt: D4HEM4
Position
complement(67691..69229)
Genome map
AA seq 512 aa AA seqDB search
MPTNDTLIRGLCPQPRQVQLTEGQFPLPSVLTWTGPDEVINAVTILTERLAPALDVVRAT
SHTDDASLTVIVDPALEAEGYRIDIDAQVRITVGSPSGARWAVQTLLQLLTPWVYGPGPL
ALKHLCLPKGVIVDAPHHSWRGAHLDVSRHFMPTSFIMNFLDVLAVHKLNRLHLHLTDDQ
GWRLPVPGWPRLTTVGAWRPGTVRGHQPPPDDNGCDDVAEHDHIPHGGAYTVDQLRAIDE
RAQLLGITVVPEVDLPGHTESVVAAYPELGCGAPISHPRTAFGVSEHHINLTDAALGFCR
DVLDAVMEIFPNSPIHIGGDECPGKEWFGHKPTRTRLAELGITTPHQAQAWFERQICGHV
VAAGRQVIAWDEVLEAGAPEEVTVMVWRDADDIARAAAAGHDVIAAPARHTYLDHGMETG
PQAPVTIDAPMTMNDVAGLHDVLAAVNSPHLLGGQFQLWTEYLCTPAQVEDAAFPRGTSI
AEQLWTGNPARPLSELEAQTRRLTAMGVNWHR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccaacgacaccctcatccggggcttgtgcccccagccccgccaggtacaactc
accgaaggacaattccccctgccgtcggtgctcacctggactggccccgacgaggtcatc
aacgccgttacgatcctcaccgagcgactggctccagcactcgacgtcgtgcgagcaaca
tcacacaccgacgatgcctccctcaccgtcatagtggatcccgctttagaagcggagggc
tatcgcattgacatcgacgcgcaggtccgcatcactgtcggcagtccatctggagcgcgt
tgggcagtgcaaaccctgctccagctgctcaccccgtgggtttacgggcccggaccgcta
gcgctgaagcacctatgccttccgaaaggcgtcatcgtcgatgcgccacaccacagttgg
cgcggggcccatctagacgtttcgcggcatttcatgcccacctcgttcatcatgaacttt
ttggacgtgctggccgtacacaagctcaatcggctgcacctacatctcactgacgatcag
gggtggcgtctgccggtaccgggctggccgcggctgaccacggtgggcgcgtggcgtcca
ggaacggtacgagggcaccaaccgccacccgacgacaacggctgtgacgacgtcgctgag
cacgaccacataccccacggtggtgcctacaccgtcgaccagctgcgcgccatcgacgag
cgagctcagctgttgggcatcacggtcgtcccggaagtcgatcttccgggacacaccgag
tcggtggtggccgcctaccccgagttgggctgtggagcaccgatcagccatccgcgcacc
gccttcggggtgtcggagcaccacatcaacctcaccgatgctgcgctgggtttttgccgc
gacgtcctggatgccgtgatggagatcttcccgaactcgccgatccacatcggcggcgac
gagtgccccggcaaggagtggtttggacataagcccacccgcacccggctagccgagctg
ggcatcacgaccccacaccaggctcaggcgtggttcgagcgccagatctgtggccacgtc
gtcgctgctgggcgtcaggtcatcgcctgggacgaggtgttggaagccggtgcgcccgag
gaggtcactgtgatggtgtggcgggatgccgacgacatcgcccgcgctgctgccgcaggt
cacgatgtcattgccgcacccgcccggcatacctacttagatcacggcatggagacgggc
ccgcaggcaccggtgacaatcgacgccccgatgactatgaacgatgtcgccgggctgcac
gacgtgctggccgcggtgaactcaccccacctgctgggtggacagttccagttgtggacc
gaatatctgtgcacccctgctcaggtcgaggatgccgccttcccgcgcggcacgtcgatc
gccgaacagttgtggactggcaacccggctcgaccgctgtcggaattagaggcccaaact
cgccgtctcaccgcgatgggggtcaattggcaccgataa

DBGET integrated database retrieval system