KEGG   Propionibacterium acnes SK137: HMPREF0675_3104Help
Entry
HMPREF0675_3104   CDS       T01215                                 

Definition
cobaltochelatase subunit (EC:6.6.1.2)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pak  Propionibacterium acnes SK137
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0675_3104
Enzymes [BR:pak01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     HMPREF0675_3104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(118177..120141)
Genome map
AA seq 654 aa AA seqDB search
MTYPFTAVVGQDEARLALLLCAVNPRIGGVILSGEKGTAKSTVVRGLVELLPGHIMRTLA
LGTTEDRLVGGLDLEATLVAGRPVLQPGLLSEVDGGVLYIDEVNLLDDHLVDLVIDACAG
TVRVEREGLTASLPSRFVLVGTMNPEEGALRPQLLDRFGLCIDVHGESDPAVRAEIIRRR
LDHDADPAEFDHRWQSDQNRQAAVIERARHIVAGVRLDEVVTELISCLCRQNHVAGHRAD
IVMAEATRAHAALVGRGVATEDDVLTISEMVLRHRRRVETPSESPPPRNQYPDDQPDQPE
QRPREPERPDPDVEKRQAGENLATPPSSSGEQQPEYHDGPQNQRDDGQHDPRKQPSGSGE
QVVAAGDPFAVRPLEPGQDRFARRACGRRLRTRSNDRRGHYVSARPTDRPDDLALDATLR
AAAVHQKSRRATERPDLAVHVKPIDWRAKVRAGRAASCVIFVVDASGSMGSRGRMTASKG
AVLSLLLDAYVKRDRVCLIGFRRDRAEVLVPVTSSVEVAQHGLAELPVGGRTPLSAGLIK
ACEVVRPLLLKDPGLRPLLILVTDGRGNVSLDGRPNSQATDEAIRVATKLGVDTRLSWVV
IDTEDPRGIQLSRARDIATALGGPCLRIDDLRADDLVNVVSRLDPSHQSPRKDR
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgacctatccgttcaccgccgtcgtcgggcaggacgaagccagactcgctctgctgctg
tgcgcggtcaacccgcgtatcggtggggtcatccttagtggggagaagggaacggccaaa
tcgacagtggttcgtggtctcgtcgagctgttacccggtcacatcatgcgcaccctggct
ctgggaaccaccgaggatcgtcttgtcggcgggttggacctggaagccaccctggtggcg
ggacgccccgtcctccagccgggtctgcttagcgaggtcgacggaggggtgctctacatc
gacgaggtcaacctcctcgacgaccacctcgtcgatctcgtcatcgacgcctgcgccggg
accgtgcgggtggagcgtgagggattgacggcctccctgccgagccgattcgtgctggtg
ggaaccatgaaccccgaggagggggcactgcgtccgcagttgttggaccggttcggactg
tgcatcgacgtgcacggcgagtccgacccggccgtccgggctgagatcatccggcggcgc
ctcgaccacgacgccgatccggccgagttcgaccaccgctggcagagcgaccagaaccgt
caggccgcagtcatcgagagggcgcggcacatcgtcgccggagtccgactggacgaggtc
gtcaccgaactcatctcctgcctgtgtcggcagaaccacgttgctgggcaccgcgccgac
atcgtcatggccgaagccacgcgggctcatgccgccctggtcggtcgcggcgtcgccacc
gaggacgacgtgttaacgatcagcgagatggtactgaggcaccgccgtcgcgtcgagacc
ccgtcggagtctccgccgccgcgcaaccagtaccccgacgatcagccggaccagcccgaa
caacgtccccgggaacccgagcgacccgaccccgacgtggaaaaacggcaggcgggcgag
aatcttgccacgccgcccagcagttcaggcgaacaacaacccgaataccacgacggtccc
cagaaccagcgagacgacggccagcacgacccgcggaaacaaccctcgggcagcggtgaa
caggtggttgccgccggggacccgttcgccgtccgccccttggaacctggtcaggaccgc
ttcgcccgtcgcgcctgcggacgacgtctgcgcacccgcagtaacgatcgacgtggccac
tacgtctcagcccgacccaccgaccgccctgacgacctcgccctggacgccacccttcgt
gcggcggcggttcatcagaagtcacgtcgggccaccgagcgtccagacctggcggtgcac
gtcaaaccgatcgactggcgggccaaagtacgggccggacgagccgcctcctgcgtgatc
ttcgtagtcgacgcttccgggtcgatggggtcacgaggacgaatgaccgcctctaagggg
gccgtgctgtccctcctcttggacgcctacgtcaagcgtgatcgggtgtgccttatcggt
ttccgtcgcgaccgggccgaggtgctggtgccggtgacctcctcggtggaggtagcccag
cacggtttggcagagctaccggtcggtgggcgcaccccgctgtcggccggactgattaag
gcctgcgaggtggtacggcccctgctcctcaaggaccccgggctgcgaccattactcatc
ctcgtcaccgacgggcgcggcaacgtcagtctggacggccgtcccaactcccaggccacc
gatgaggcgattcgggtggcaaccaagctcggcgtcgacacacgactcagctgggtcgtc
atcgacaccgaggacccacgaggtatccagctgtctcgggcccgcgacattgccacagcc
ttgggtggaccttgtctgcgcatcgacgacctgcgggctgacgacctcgtcaacgtcgtc
tctcgacttgacccctcccaccaatctccccgaaaggaccgctga

DBGET integrated database retrieval system