KEGG   Propionibacterium acnes SK137: HMPREF0675_3104Help
Entry
HMPREF0675_3104   CDS       T01215                                 

Definition
(GenBank) cobaltochelatase subunit
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pak  Propionibacterium acnes SK137
Pathway
pak00860  Porphyrin and chlorophyll metabolism
pak01100  Metabolic pathways
pak01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0675_3104
Enzymes [BR:pak01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     HMPREF0675_3104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase AAA_5 MCM VWA VWA_CoxE AAA_16
Motif
Other DBs
NCBI-ProteinID: ADE00191
UniProt: D4HF43
Position
complement(118177..120141)
Genome map
AA seq 654 aa AA seqDB search
MTYPFTAVVGQDEARLALLLCAVNPRIGGVILSGEKGTAKSTVVRGLVELLPGHIMRTLA
LGTTEDRLVGGLDLEATLVAGRPVLQPGLLSEVDGGVLYIDEVNLLDDHLVDLVIDACAG
TVRVEREGLTASLPSRFVLVGTMNPEEGALRPQLLDRFGLCIDVHGESDPAVRAEIIRRR
LDHDADPAEFDHRWQSDQNRQAAVIERARHIVAGVRLDEVVTELISCLCRQNHVAGHRAD
IVMAEATRAHAALVGRGVATEDDVLTISEMVLRHRRRVETPSESPPPRNQYPDDQPDQPE
QRPREPERPDPDVEKRQAGENLATPPSSSGEQQPEYHDGPQNQRDDGQHDPRKQPSGSGE
QVVAAGDPFAVRPLEPGQDRFARRACGRRLRTRSNDRRGHYVSARPTDRPDDLALDATLR
AAAVHQKSRRATERPDLAVHVKPIDWRAKVRAGRAASCVIFVVDASGSMGSRGRMTASKG
AVLSLLLDAYVKRDRVCLIGFRRDRAEVLVPVTSSVEVAQHGLAELPVGGRTPLSAGLIK
ACEVVRPLLLKDPGLRPLLILVTDGRGNVSLDGRPNSQATDEAIRVATKLGVDTRLSWVV
IDTEDPRGIQLSRARDIATALGGPCLRIDDLRADDLVNVVSRLDPSHQSPRKDR
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgacctatccgttcaccgccgtcgtcgggcaggacgaagccagactcgctctgctgctg
tgcgcggtcaacccgcgtatcggtggggtcatccttagtggggagaagggaacggccaaa
tcgacagtggttcgtggtctcgtcgagctgttacccggtcacatcatgcgcaccctggct
ctgggaaccaccgaggatcgtcttgtcggcgggttggacctggaagccaccctggtggcg
ggacgccccgtcctccagccgggtctgcttagcgaggtcgacggaggggtgctctacatc
gacgaggtcaacctcctcgacgaccacctcgtcgatctcgtcatcgacgcctgcgccggg
accgtgcgggtggagcgtgagggattgacggcctccctgccgagccgattcgtgctggtg
ggaaccatgaaccccgaggagggggcactgcgtccgcagttgttggaccggttcggactg
tgcatcgacgtgcacggcgagtccgacccggccgtccgggctgagatcatccggcggcgc
ctcgaccacgacgccgatccggccgagttcgaccaccgctggcagagcgaccagaaccgt
caggccgcagtcatcgagagggcgcggcacatcgtcgccggagtccgactggacgaggtc
gtcaccgaactcatctcctgcctgtgtcggcagaaccacgttgctgggcaccgcgccgac
atcgtcatggccgaagccacgcgggctcatgccgccctggtcggtcgcggcgtcgccacc
gaggacgacgtgttaacgatcagcgagatggtactgaggcaccgccgtcgcgtcgagacc
ccgtcggagtctccgccgccgcgcaaccagtaccccgacgatcagccggaccagcccgaa
caacgtccccgggaacccgagcgacccgaccccgacgtggaaaaacggcaggcgggcgag
aatcttgccacgccgcccagcagttcaggcgaacaacaacccgaataccacgacggtccc
cagaaccagcgagacgacggccagcacgacccgcggaaacaaccctcgggcagcggtgaa
caggtggttgccgccggggacccgttcgccgtccgccccttggaacctggtcaggaccgc
ttcgcccgtcgcgcctgcggacgacgtctgcgcacccgcagtaacgatcgacgtggccac
tacgtctcagcccgacccaccgaccgccctgacgacctcgccctggacgccacccttcgt
gcggcggcggttcatcagaagtcacgtcgggccaccgagcgtccagacctggcggtgcac
gtcaaaccgatcgactggcgggccaaagtacgggccggacgagccgcctcctgcgtgatc
ttcgtagtcgacgcttccgggtcgatggggtcacgaggacgaatgaccgcctctaagggg
gccgtgctgtccctcctcttggacgcctacgtcaagcgtgatcgggtgtgccttatcggt
ttccgtcgcgaccgggccgaggtgctggtgccggtgacctcctcggtggaggtagcccag
cacggtttggcagagctaccggtcggtgggcgcaccccgctgtcggccggactgattaag
gcctgcgaggtggtacggcccctgctcctcaaggaccccgggctgcgaccattactcatc
ctcgtcaccgacgggcgcggcaacgtcagtctggacggccgtcccaactcccaggccacc
gatgaggcgattcgggtggcaaccaagctcggcgtcgacacacgactcagctgggtcgtc
atcgacaccgaggacccacgaggtatccagctgtctcgggcccgcgacattgccacagcc
ttgggtggaccttgtctgcgcatcgacgacctgcgggctgacgacctcgtcaacgtcgtc
tctcgacttgacccctcccaccaatctccccgaaaggaccgctga

DBGET integrated database retrieval system