KEGG   Propionibacterium acnes SK137: HMPREF0675_3156Help
Entry
HMPREF0675_3156   CDS       T01215                                 

Gene name
pfkB
Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
pak  Propionibacterium acnes SK137
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0675_3156 (pfkB)
   01230 Biosynthesis of amino acids
    HMPREF0675_3156 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0675_3156 (pfkB)
   00030 Pentose phosphate pathway
    HMPREF0675_3156 (pfkB)
   00051 Fructose and mannose metabolism
    HMPREF0675_3156 (pfkB)
   00052 Galactose metabolism
    HMPREF0675_3156 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0675_3156 (pfkB)
Enzymes [BR:pak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF0675_3156 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(177699..178649)
Genome map
AA seq 316 aa AA seqDB search
MIVTVTLNPSIDRTAPIAGPLRRGQVNRLGSSTEVAAGKGVNISRVLRGAGIETCAVVPA
GAKGRLTLGLNHDDIPHQVVPVAAAVRTNLTITEPDGTTTKINEPGADLSPEELTAVEEA
IVEKSSGAQWVVLSGSLPPGVPTHWYATMTDRLHEIGVKVAVDTSDQPLQELAARLPDCA
PDLVKPNSVELGQLCGIDGDSLESAATRGQFDDVVVAARGLHGIAEVIVTLGGTGALLIT
EHDAWHARPEPVEVKSTVGAGDSSLAGFLLARTRGDQPENCLRAAVAWGTAAAALPGSTM
PTPSQADAIHVSLTHL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcaccgtcacgctcaacccgagcattgaccgcacagcgcccatagctgggccg
ctgcggcgcgggcaggtgaaccgactcggcagttccaccgaggtcgccgccggtaagggg
gtcaacatctcacgagtccttcgtggggctggaatcgaaacctgcgccgtggtgccagcc
ggagccaagggccgcctgaccctcggcctcaaccacgacgacatcccgcaccaagttgta
cccgttgcggcagcggtgagaaccaacctcaccatcaccgaacctgacggcactacaacc
aagatcaatgagcccggagccgacctcagtcctgaggagctgaccgcagttgaggaggcc
atcgtcgagaagtcctccggcgcgcaatgggtcgtactgtcaggatccttacccccgggc
gtacccacacattggtatgccacaatgaccgaccgcctccatgagatcggcgtcaaagtc
gccgtcgacacctccgatcaacccctccaagagctggcggcccgcctccccgactgtgcc
cctgaccttgtcaagccgaactccgtcgagctcggccaactatgcgggattgacggcgac
tctctcgagtctgctgccacaaggggacagttcgacgacgttgtcgtggccgcccgaggt
ctgcacggcatcgccgaggtaatcgtcaccttgggcgggaccggcgctctgctcatcacc
gaacacgacgcctggcacgcccggccagagccggtcgaggtgaagtcgactgttggcgcc
ggagactcctccctggccggattcctgctggcgcgcacccgcggcgaccagcccgaaaac
tgcctgcgcgccgccgtggcgtggggcacagcagccgccgctctaccggggtcaaccatg
ccgaccccgtcacaggccgacgccattcacgtcagcctcacccacctgtaa

DBGET integrated database retrieval system