KEGG   Propionibacterium acnes SK137: HMPREF0675_3250Help
Entry
HMPREF0675_3250   CDS       T01215                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pak  Propionibacterium acnes SK137
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pak00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF0675_3250 (recR)
DNA repair and recombination proteins [BR:pak03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HMPREF0675_3250 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
282602..283207
Genome map
AA seq 201 aa AA seqDB search
MYDGPLQELIDALSRLPGIGPKGAQRIAFHILDAPAEEANELADALREVKEKAKFCKICF
NVSSDEVCQYCRDPRRDQSMICVVEESKDVIAVERTRQFRGLYHVLGGAISPLDGKGPAD
LHIRELCQRLADETVTEVILATNPNLEGEATATYLSRLIAPMGVTVSRLASGLPVGGDLE
YADEVTLGRAFEGRLHVGVGA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacggtccgctgcaagaactcattgacgccctttctcggctaccggggatcggg
ccgaagggtgcgcagcggatcgcttttcatatcctcgacgctcctgcggaggaggccaat
gaactggccgacgccttgcgcgaggtcaaagagaaggccaagttctgcaagatttgtttt
aatgtctcctccgacgaggtgtgccagtactgccgtgatccgcgtcgggaccagtcgatg
atctgtgttgttgaggagtccaaagacgttattgctgtggagcgtacccgacaattccgt
ggtctgtatcacgttcttggcggagcgatctcgccgttagacggaaaaggcccagctgat
ctccacatccgtgaattgtgccagcggttggctgacgaaaccgttaccgaggtgatcctg
gccaccaacccgaaccttgagggggaagcaacggcaacgtatctttcccgcctcatcgcg
cccatgggcgtgacggtgtcccgactagcctctggtttgccggttggcggcgacctggaa
tacgccgacgaggtcaccctggggcgcgccttcgagggacgcctccatgtgggagttggt
gcctga

DBGET integrated database retrieval system