KEGG   Propionibacterium acnes SK137: HMPREF0675_3308Help
Entry
HMPREF0675_3308   CDS       T01215                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pak  Propionibacterium acnes SK137
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pak00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341947..342522
Genome map
AA seq 191 aa AA seqDB search
MKLSVDRERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGELLATTF
DISHDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEVYARRPQ
VQERLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRGILRNPATR
AEAMGLITAGR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtccgttgatcgcgagcgagccgcggcagctatccgcgagtttcttctggcg
gtcggcgaggatcccgatcgggaaggcctgcgcgatactccaatgcgagtggcccaggcg
gccgaggagctatttggcggattgagccaagatccgggggagttgctggcaacgaccttc
gacatctcccacgacgagatggtgttggtgcgtgatattgagttgcagtcgatgtgtgag
caccatctgctgcccttcatcggggtagcgcacgtcggttatattccggctagggacggc
cgggtgacggggttgagtaagatcgcgaggttggtggaggtctatgcgcgtcgaccccag
gtacaggagaggttgacgacccaggtggccgacgccttggtagaacatttggacgctcgt
ggcgtgatcgtggttgttgaggccgagcacatgtgcatgacgacgaggggggtccgcaag
ccgggggcccggacggtgacctccgcggtgcgcgggattctgcgcaacccagcgacgcgg
gccgaggcgatggggctgatcacggctggacgttga

DBGET integrated database retrieval system