KEGG   Propionibacterium acnes SK137: HMPREF0675_3346Help
Entry
HMPREF0675_3346   CDS       T01215                                 

Gene name
hemD_1
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pak  Propionibacterium acnes SK137
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0675_3346 (hemD_1)
Enzymes [BR:pak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HMPREF0675_3346 (hemD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(375195..375920)
Genome map
AA seq 241 aa AA seqDB search
MTTNPADLVKPPVVVPRDDSHDKFVTTLKQAGYGVIHTALTRTVTLPDAERLTAPDLWQA
DWLVVTSKTTVGLLPTPLPNPNIKVAAVGAATSAALRTRGIDVDFVPENHSGAGLVAEWP
GGVASILLPASQLTADTVPLGLTKVGCTVNRLEIYTTAAVEKLPEVIAQSWPSVGVVVVT
ASSVGRALVELVEPLGWRRQKLVALGKPTARTLEVLGHPAHAVASSPTPEAVLEAVESLV
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaaatcctgccgatctcgtcaagcccccagttgttgttccccgtgacgactcc
cacgacaaattcgtgacgactttgaagcaggccggttatggagtgatccacacagcgctg
acgcgcaccgtcaccttgccggatgcggagaggcttactgcccctgacctgtggcaggcc
gactggctggtcgtcacctcgaagaccaccgtcggactgctccctaccccgttgccgaat
cccaacatcaaagtagctgcggtcggcgccgctacctctgctgcgctgcgcacacgtggg
attgacgtcgacttcgtccccgagaatcacagcggcgctggtctggtcgccgagtggcca
ggtggagtcgccagtatcctcctaccagcgtcccagttaaccgccgataccgtaccgctg
gggctgacgaaggtcggctgcacggtaaaccgattggagatctataccaccgctgccgtc
gagaaactgcctgaggtcatcgcccagtcgtggccgtctgtcggggtcgtcgtcgtcact
gcctcctcggtgggacgtgccctcgtcgagctggtagagccgctgggatggcgtcgtcag
aagctcgtcgccctcggtaagcccactgcaagaacactcgaagtactcggtcacccagcg
catgcggtggcctcctcccccactcctgaagccgtccttgaggcggttgagtccttggtc
gcctga

DBGET integrated database retrieval system