KEGG   Propionibacterium acnes SK137: HMPREF0675_3405Help
Entry
HMPREF0675_3405   CDS       T01215                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pak  Propionibacterium acnes SK137
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0675_3405
   01230 Biosynthesis of amino acids
    HMPREF0675_3405
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0675_3405
  Energy metabolism
   00680 Methane metabolism
    HMPREF0675_3405
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0675_3405
Enzymes [BR:pak01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0675_3405
Exosome [BR:pak04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0675_3405
  Exosomal proteins of melanoma cells
   HMPREF0675_3405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(433486..434235)
Genome map
AA seq 249 aa AA seqDB search
MTAKLILLRHGESEWNSKNLFTGWVDVDLNEKGEGEARHAADLLKQENLLPDIVHTSLLR
RAIHTAYLALDGCDRHWIPVHRSWRLNERHYGALQGLNKAETKEKYGNDQFMAWRRSYDV
RPPDLDRDSEFSQFHDPRYADIPASERPVAECLKDVVARMVPYFTSDIAADLKDGKTVLV
AAHGNSLRALVKHLDEISDEDIAGLNIPTGIPLFYELDDNLKPVTRGGRYLDPEAAAAGA
KAVANQGNK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagctcatcctgctccgccatggcgagagcgaatggaactccaagaacctc
ttcaccggctgggtggacgtcgatctcaacgagaagggcgagggcgaggctcgtcacgcc
gccgacctgctcaagcaggaaaacctcctgcccgatatcgtccacacctcgctgctacgt
cgtgctatccataccgcctacctagcccttgacggctgcgaccgccattggatcccggtg
catcgctcctggcgcctcaacgagcgtcactacggtgcgctgcagggtctcaacaaggct
gagaccaaggagaagtacggcaacgaccagttcatggcttggcgtcgctcctacgatgtt
cgtccaccggaccttgaccgcgacagcgaattcagccagttccatgacccgcggtacgcc
gacatcccggcgtccgagcgtccggtcgccgagtgtctcaaagacgtcgtggcccgcatg
gtgccgtacttcacctctgatattgctgccgaccttaaggacggcaagacggtgctcgtg
gctgctcacggtaactccctgcgcgccctcgtcaagcacctcgacgagatcagtgacgag
gacatcgccggcctcaacatcccgaccggtatcccgctgttctacgagcttgacgacaac
ctcaagcccgtgactagggggggccgctacctcgaccctgaggccgctgccgccggcgcc
aaggcagtcgctaaccagggaaacaagtaa

DBGET integrated database retrieval system