KEGG   Propionibacterium acnes SK137: HMPREF0675_3438Help
Entry
HMPREF0675_3438   CDS       T01215                                 

Definition
ABC transporter, substrate-binding protein, QAT family
Orthology
K05845  
osmoprotectant transport system substrate-binding protein
Organism
pak  Propionibacterium acnes SK137
Pathway
ABC transporters
Module
Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:pak00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    HMPREF0675_3438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(468028..468951)
Genome map
AA seq 307 aa AA seqDB search
MITTPMTRRTLLGTALLTGLAACSSNDPLNSDGSGSGSADLIVGSANFTESEIIAEVYAQ
SLETVGITIKRRMQIGARDVYVKALQDGSVNLVPEYSGNLLQFFQGASSASDEKSVMASL
RKAVPAGMSVGEPSAAQDADSWCVTTEFSHTHKVTSLTDLATLDSLKVGGNPELKERPYG
PKGLTKAYGVPSSIVKFTALSDSSGPLTVKALTLGTVDLVDLYTTTPAIKEQHLVVLSDP
RHLIVPQNVVPLLSKKVDDKARAQLARVSKALTTDDLIGMNQRFQGDEKASAATIAKDWL
AQRGLAS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatcacaacgcccatgacccgccgaaccctgctcggaacagcgttgctgaccggtctg
gcagcatgttcctcaaacgaccccctcaattcggatggctcgggatccggtagcgcagac
ctgatcgtcggttcggcgaattttaccgaatctgagatcatcgccgaggtctacgctcag
agtctcgagacggtcgggatcacgatcaaacgtcgcatgcagatcggtgcccgagacgtc
tacgtcaaggcccttcaagacggttcggtcaacctcgtcccggagtactcaggaaatctg
ctgcagttcttccagggggcatcgtccgcctccgacgagaagtccgtcatggcctccctg
cgcaaagccgtgcccgccggtatgtcggtgggagaaccctcggcagctcaggatgccgat
tcctggtgcgtcaccaccgaattctcacacacccacaaggtgacttccctcaccgatcta
gccacgttagattccctcaaagtgggcggcaaccccgaactcaaagaacgaccctacggc
ccgaaggggttgacgaaggcgtacggcgtaccatcctccatagtcaagttcaccgcccta
tcagattcctcgggcccgctcaccgttaaggcactgaccttggggacggttgatctcgtt
gacctctacacaacgaccccagcgattaaggaacagcacctcgtcgtcctctccgacccc
aggcatctcatcgtgccgcaaaacgtcgtcccacttttaagtaagaaggttgatgacaag
gcacgtgcccaactggccagggtgtcgaaagcgctgaccaccgacgatctcatcgggatg
aaccagcgctttcagggagacgaaaaagcatccgcagccaccatcgccaaggattggtta
gcacaaagggggctggcctcataa

DBGET integrated database retrieval system