KEGG   Propionibacterium acnes SK137: HMPREF0675_3534Help
Entry
HMPREF0675_3534   CDS       T01215                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pak  Propionibacterium acnes SK137
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0675_3534
   00052 Galactose metabolism
    HMPREF0675_3534
   00500 Starch and sucrose metabolism
    HMPREF0675_3534
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0675_3534
Enzymes [BR:pak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF0675_3534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
558119..559516
Genome map
AA seq 465 aa AA seqDB search
MSEEGLAAARQKMTEAGVDPVAIEVFTSYYHQLETGDTGLIREDTISPLTNPPMLDDVEV
SEEQAAEALDKTVIIKLNGGLGTSMGLDRAKSLLEVRDGKSFLDIIATQVLSARKTFGAR
LPLMFMNSFNTREDTLKALEKYPELAVDGLELDFLQDQEPKLDAETLAPVEWPKDSSLEW
CPPGHGDLYTALLGSGVLDHLLEAGYQYASVSNGDNLGAVPDGRLAGWFAASGAPYAAEL
CRRTINDKKGGHLAIRKSDDQLILRDTAQTAEEEMDYFTDEHRHPFFHTNNLWFDLEALK
KVLDERHGVMGLQIIRNEKTVDPKDSSSTPVIQIESAMGGAIEVFEGATCICVHRSRFLP
VKTTNELLLLRSDVYDLDDSDHLVKTTDMTCAVDLDKDFYKKIGDFDDRIPEPPSLRRAT
SLKVKGDWTFGSEVVVAGDVSLDTEKPQTIPDGTVLTGEVLGAKK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaaggacttgcggctgcacgccagaagatgaccgaggcaggtgtcgatcct
gtcgccatcgaggtcttcacttcctactaccaccagctcgagaccggcgataccggactc
atccgcgaggacaccatctcaccgctcacgaatccgccaatgcttgacgacgttgaggtc
agcgaggagcaggctgctgaggccctcgacaagaccgtcatcatcaagctcaatggcggg
ctcggaacctcgatgggcctcgaccgagctaagtcgctgctcgaggttcgtgacggcaag
tccttcctcgacatcatcgctacccaggtgctctcggctcgcaagactttcggcgctcga
ttgccgctgatgttcatgaattccttcaatacccgcgaggacaccctcaaggccctcgag
aaatatccagagttggctgtcgacggcctagagctcgacttcctgcaggatcaggagcct
aagctcgacgctgagaccctcgccccggttgagtggccgaaggactcctccctcgagtgg
tgtcctccgggtcacggcgacctctacaccgctctgcttggatccggcgtcctcgaccat
ctgctcgaggctggataccaatacgcctcggtatccaacggtgacaatcttggtgccgtt
ccggacggtcgtctcgccggctggtttgcggcgtcgggtgctccctacgctgccgagttg
tgccgccgcactattaacgacaagaagggtggccacctggccattcgtaagtctgatgat
cagctcatcctgcgcgatacggcacagacagcagaagaggaaatggattacttcaccgac
gagcatcgtcaccccttcttccacaccaacaatctgtggtttgaccttgaagccctcaag
aaggtgctggacgagcgacacggcgtgatgggcctgcaaattattcgcaacgagaagacg
gtcgacccgaaggattcctcgtcgactcctgtcatccagattgagtccgctatggggggc
gctatcgaggtctttgaaggcgctacctgtatctgtgttcatcggtcccggttcttgccg
gtcaaaacgaccaacgagctgctgctgcttcggtctgatgtttatgacctcgacgattcg
gaccacctcgtcaagaccaccgacatgacctgcgcagtcgatcttgacaaggatttttat
aaaaagattggtgatttcgacgatcgcatccctgaaccgccatcgctgcgccgcgccacc
tcgctgaaggtcaaaggagactggacctttggttcggaggttgtcgttgcgggggatgtt
tcgctggatactgagaagcctcagacgattccggacgggaccgtgctcactggcgaagtc
cttggcgcgaaaaagtga

DBGET integrated database retrieval system