KEGG   Propionibacterium acnes SK137: HMPREF0675_3591Help
Entry
HMPREF0675_3591   CDS       T01215                                 

Definition
oxidoreductase, zinc-binding dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pak  Propionibacterium acnes SK137
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HMPREF0675_3591
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0675_3591
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0675_3591
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF0675_3591
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF0675_3591
   00626 Naphthalene degradation
    HMPREF0675_3591
Enzymes [BR:pak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF0675_3591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(608855..609910)
Genome map
AA seq 351 aa AA seqDB search
MKAALVEQYHEPLAIRDIPEPAHDSDGVVVEVKACGVCRSDWHGWQGEWPGFTGGSLPHI
FGHEFVGLVSDIGNNVSRYRVGDRVIVPFTLGCGHCEYCRSGHSNVCPTVSMPGFSYDGG
FAQYVTVPDADANLVKLPDAVDFTDAAGMGCRLMTAYHGIVEVGQIHPGDWLVVYGAGGV
GLSATLVATSAGANVIAVDIADDKLALARKVGAIATINSRETDPVEAVRELTDGGADKSV
DALGISETLHNAVNSLRSRGTHIQIGMTAEGPVGDVALTINDLIAKEIDFRGSFGMPAVE
FRYLLNQVAAGKMKPGQLVTKTIALSEVNDALTAMSTYNTVGTTVITDFTR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcactagttgagcagtaccacgaaccattagccatcagggatattcctgag
ccagctcatgattcggacggtgtggtcgtcgaggtgaaagcctgcggcgtctgtcgaagc
gactggcacggctggcagggcgagtggccaggatttaccggcggctccttgcctcacatc
ttcggacacgagttcgtcgggctggtcagtgacatcggcaacaacgtgagccgataccgc
gtgggagaccgggtgattgtccccttcacattgggttgcggtcactgcgagtactgccgg
agcggtcattcaaacgtctgccctaccgtgtccatgcccggtttcagctatgacggcgga
ttcgcgcaatatgtcaccgtccccgacgcagatgccaacctcgtgaagctccccgacgcc
gtcgatttcaccgatgctgcgggtatgggctgccgcctcatgaccgcctaccacggcatc
gtcgaggtgggacagatccaccccggtgactggcttgtcgtctatggtgcaggcggcgtg
ggtctgtcggccaccctcgtcgctaccagcgcaggggcaaacgtcattgccgtcgacatc
gcagatgacaaacttgccttggctcgcaaggtcggggctatcgcgaccatcaattcgcgc
gaaaccgacccagtggaggcagttcgtgagctgaccgacggaggcgcggacaagagcgtc
gacgccctgggcatttccgaaactctgcacaacgcggtcaactcattgcgttcccgagga
acccatattcagatcggcatgactgcagaggggccagtcggcgacgtggcgttgacgatc
aacgacctcattgccaaggagattgatttccgggggtccttcggaatgcctgccgtcgag
ttccgttacctgctcaatcaggttgctgcgggcaagatgaaaccaggccagctcgtcacc
aaaaccatcgcactgagtgaggtgaacgacgctctcaccgccatgtccacctacaacacg
gtgggaaccaccgtcattaccgacttcacacgctga

DBGET integrated database retrieval system