KEGG   Propionibacterium acnes SK137: HMPREF0675_3674Help
Entry
HMPREF0675_3674   CDS       T01215                                 

Definition
L-fucose isomerase, second N-terminal domain protein
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
pak  Propionibacterium acnes SK137
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HMPREF0675_3674
Enzymes [BR:pak01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     HMPREF0675_3674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
690183..690758
Genome map
AA seq 191 aa AA seqDB search
MGVCADLTVTASWDCIAEILDLTPDIPHARGFNATERSGAVTVAAAMAAYTQLGILAFAI
YGHDVQNADDALTDDVSARILSFGRAALAVGLMRVRSYLAMGTVSMGIAGCHVPEQALQD
YLGMRSQYIDMVELGRRITAGIYDHVEWKWAMAWVSASVRTEIRLTSSTAMLTSVNSWSI
RSRWCWLPETS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtctgtgcggatctcaccgtcaccgcctcgtgggactgcatcgccgaaatcctc
gacctgactccggacattccgcacgcgagggggttcaacgccactgaacgttctggagcc
gtcaccgtggctgcggccatggcggcctacacacagctgggtattctggccttcgccatc
tacggtcatgatgttcagaatgccgacgacgccctcactgacgacgtctcggcccggatt
ctcagcttcggacgagccgccctggcagtcgggctcatgagagtccggagctacttggcg
atgggcaccgtgtcgatgggcattgccggatgtcatgtccctgagcaggcccttcaggat
tacttgggcatgcgcagccagtacatcgacatggtggaactcggccgcaggatcaccgcg
ggtatctatgaccacgttgagtggaagtgggcgatggcatgggtctcagcatcggtgagg
accgaaatccggctgacaagcagcacagcgatgctgacaagcgtgaacagctggagtatt
cggtcaagatggtgctggttgcccgagacctcatga

DBGET integrated database retrieval system