KEGG   Propionibacterium acnes SK137: HMPREF0675_3675Help
Entry
HMPREF0675_3675   CDS       T01215                                 

Definition
L-fucose isomerase, C-terminal domain protein
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
pak  Propionibacterium acnes SK137
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pak00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
690731..691696
Genome map
AA seq 321 aa AA seqDB search
MVLVARDLMNGNLRLADMGFKEEAGGYDAIAAGFQGKRQWTDGKLNGDVMETLLNTSFDS
DGLRQPQVFATEGDALNGIAMLLGSLLTQRPQFSSDVRTYWSPEAVRRVTGHELTGRAAG
GFVDFRNSGASTLNATECEAEADGTPVIKHWWDLTEDDIQADLAATTFHSATQEYFPGGG
FSTHFTTVGDTTVTAVRMNMVAGVGPTLQIVEGRTLPDEGTDTIVERADPTWPTTFFVSR
IPSSGAFSSVYDWMDKWGANHTSTGYSHIGADVLTLAAMLRIPVSMHNIETKDIFRPRTW
SSSEPSSNRRARDTDRRVRPS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggttgcccgagacctcatgaacggcaatttgcgtctggccgacatgggattc
aaggaagaggccggtggttacgacgccatcgccgccggcttccagggcaagcgtcagtgg
actgatggcaagctgaacggcgacgtcatggaaaccctgctcaacaccagcttcgactcg
gatggactgcgtcagccccaggtctttgccaccgagggagatgccctcaacgggatagcg
atgctgctcggcagcctcctcactcagcgtcctcagttctctagcgatgtccgtacctat
tggagcccggaggccgttcgccgcgtcaccggtcatgagctgaccggtcgtgccgctggt
ggtttcgtcgatttcaggaattccggcgcgagcactctcaacgcgacagaatgcgaggcc
gaggcggacggcactcccgtcatcaagcactggtgggatctcaccgaggacgacatccag
gccgatctcgctgcgacgaccttccactcggcgacccaggagtacttcccgggcggcgga
ttctcgacccacttcacgacggtgggggacacgacggtgacagcggttcgtatgaacatg
gtcgctggagttggaccgaccctgcagattgtcgagggacggacgctcccggacgagggg
acagacaccatcgttgagcgggcggacccgacgtggccgacaacgttcttcgtgtcgcgc
attccctcgagcggagccttcagtagcgtttatgactggatggataagtggggagctaac
cacacctcgacggggtacagccatatcggcgctgacgttctcaccctggcagccatgctg
cgcatcccggtctcgatgcacaacattgagaccaaggacatcttccgtccgcgtacctgg
tcctcgtcggaaccgtcgtcgaaccgccgtgcgagggataccgaccgacgagtgaggccc
tcatga

DBGET integrated database retrieval system