KEGG   Propionibacterium acnes SK137: HMPREF0675_3762Help
Entry
HMPREF0675_3762   CDS       T01215                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pak  Propionibacterium acnes SK137
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0675_3762 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF0675_3762 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HMPREF0675_3762 (sucB)
Enzymes [BR:pak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HMPREF0675_3762 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(783079..784458)
Genome map
AA seq 459 aa AA seqDB search
MSTEVTLPALGESVTEGTVSRWLKAVGDTVEADEPLLEVSTDKVDTEVPSPASGTLLEIK
VPEDEDAEVGAVLAIIGDPSAVESAPAPAKPTAEPAEKAKPEPVKSEAEEAPAPTAPKPA
EAPKPAGTNEVAPRATNPSSDVYVTPLVRKLARENNVDLSTITGTGVGGRIRKQDVLAAA
GKSGEAPSAPQAPAAAPAPAAPKPAGSARKASQEVSPEAAALRGTTEKMSRLRKVIASRM
VESLQISAQLTATVEVDMTAISRIRNAEKAAFKAREGVGLSYLPFITKAVVEALKANPTF
NANIDTEAGTITYGSSENIGIAVDTPRGLLVPVIKNAGDLNIAGLTHQIGDLAARTRDNK
VTPDELSGGTFTITNYGSAGALFDTPIVNQPEVAILGTGALVKRPVVVTNEFGEDTIAVR
DMMYLSLSYDHRLIDGAVAARFLSGIKARLEEGDFAGEF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagtcactcttcctgcactgggcgagtccgtcaccgaaggcaccgtgtcc
cgctggctcaaggctgtcggagacaccgtcgaggccgacgaacccttacttgaggtgtcc
accgacaaggtcgataccgaagtcccctcccccgcctccggcaccctacttgagatcaag
gtccccgaagacgaagacgccgaagtcggcgccgtcctagccatcatcggcgacccctct
gctgtcgagtcggcccctgcgcctgctaagccgacggctgagcccgcggagaaggccaaa
cctgagccggtgaagagcgaggccgaggaggcaccggcgccgaccgcgccgaagcccgcc
gaggctcccaaacccgccgggaccaatgaggtcgccccacgcgccaccaacccgtcgtcg
gacgtctacgtcaccccgctagtccgcaagctcgcccgggagaacaacgtcgacctgtcg
acgatcaccggaactggtgtcgggggtcgtattcgcaagcaagacgtactagctgcagcc
ggtaagtctggagaagctccctcagctcctcaggcaccggctgccgcccctgccccggct
gctccgaaaccggctggttcagcccgtaaagcctcccaggaagtctctccggaagctgcc
gctctgcgcggcaccaccgagaagatgagccgtctacgcaaggtcatcgcctcgcggatg
gttgagtccctgcagatctcggctcagttgacggccaccgtcgaggtggacatgaccgct
atctcccgcatccgcaacgctgagaaggctgctttcaaggcccgcgagggagtcggtctg
tcctacttgcctttcattaccaaggccgtcgttgaagccctcaaggccaatccgaccttc
aacgcaaatatcgacaccgaggcggggacgattacctacggttcttctgagaacatcggc
atcgccgttgataccccgcgcgggctgctggttccggtcatcaagaacgctggtgatctc
aatatcgctgggctgacccaccagattggcgatctcgctgcccgcacccgcgacaacaag
gtgacccctgacgagctgtccggcggcaccttcaccatcaccaactatggctcggctgga
gccctcttcgacaccccgatcgtcaaccagcccgaggtcgccatcctcggcaccggtgct
ctggttaagcgcccagtcgtcgtcaccaacgagttcggcgaggataccatcgcagtccgc
gacatgatgtacctctcgctgtcctacgatcaccggctcattgacggcgctgtggcggct
cgcttcctatcgggcatcaaggctcgtctggaggagggcgacttcgccggagagttctga

DBGET integrated database retrieval system