KEGG   Propionibacterium acnes SK137: HMPREF0675_3791Help
Entry
HMPREF0675_3791   CDS       T01215                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pak  Propionibacterium acnes SK137
Pathway
pak00010  Glycolysis / Gluconeogenesis
pak00052  Galactose metabolism
pak00500  Starch and sucrose metabolism
pak00520  Amino sugar and nucleotide sugar metabolism
pak00521  Streptomycin biosynthesis
pak01100  Metabolic pathways
pak01110  Biosynthesis of secondary metabolites
pak01120  Microbial metabolism in diverse environments
pak01130  Biosynthesis of antibiotics
pak01200  Carbon metabolism
Module
pak_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pak_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0675_3791
   00052 Galactose metabolism
    HMPREF0675_3791
   00500 Starch and sucrose metabolism
    HMPREF0675_3791
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0675_3791
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF0675_3791
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HMPREF0675_3791
Enzymes [BR:pak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF0675_3791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase Hydant_A_N FGGY_N GST_N_2
Motif
Other DBs
NCBI-ProteinID: ADD98990
UniProt: D4HCP7
Position
812213..813283
Genome map
AA seq 356 aa AA seqDB search
MLSVGIDIGGTKVAAGVVDESGQIVRRIQRLTPSRSPEAVEDAIVESVRELARNLPICAV
GIGAAGWIDTEQALVRFSPHLAWRNEPLRDRLSERITVPVLVDNDANAAAWAEFRFGAGQ
GSRVMVCLTLGTGIGGALVINGRMFRGRYGMAGEFGHMTVVPDGHWCPCGNRGCWEQYAS
GNSLVRDARALLAEGAPGAQDLLGYVADRNPGNLIGPDVTRAAVDGDRLAIELIADIGIW
LGRGMANLAAALDPDLFVIGGGVSAAGDLLLEPARTVYARTLTGRGFRPMADIQKAHFGN
DAGLIGAADLARHSINEPPGMARGFWPRRRTAVRKPRRTLRQSLSETLAGPVVRDK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcttagcgttggcatagatattggcggcacgaaggttgccgctggtgtcgtagatgaa
agtggccagattgttcggcgtattcagcgcctgacaccctcgcgcagccccgaggctgtt
gaggacgctatcgttgagtcggtccgtgaattggctcgtaacctccctatctgtgctgta
ggcatcggggcagccggctggatagacactgaacaggcgctcgtgcggttttccccgcat
ttagcatggcgtaatgagccgctgcgcgatcgtctgtctgagcgcatcactgtgcctgtt
ctcgtcgataatgacgccaatgcggccgcgtgggctgagttccggttcggagccggacaa
ggatcacgggtcatggtgtgcctgacgttgggaacgggtatcgggggtgcactcgttatc
aatgggcggatgttccgcggccgatacggcatggccggagaattcggacatatgacggtg
gttcccgatggccactggtgcccatgtggcaaccgtggttgctgggagcaatacgcctcc
ggaaattccctcgtgagggatgctcgagcgttgcttgccgagggagctcccggtgctcag
gatctgttgggttatgtagctgaccgcaatccgggcaacctcattggtcctgatgtcaca
cgcgcagcggtcgatggcgatcgtcttgccattgagctcattgcagacattggcatctgg
ctgggccgtggaatggcgaacttggcagcagccttagatccagatctctttgtcattggt
gggggagtgagcgccgccggagacctcttgcttgaacctgcgcgcactgtatatgcccgc
acgctgacgggccgggggttccgcccgatggccgatattcagaaggcacatttcggtaac
gatgctgggcttatcggcgccgcagacttggctcgccactccatcaacgaaccgccgggc
atggctcgcgggttctggccacgtcgtcgtactgctgtccgcaagccacgccgtactttg
cgtcagagcctgagtgaaactctcgccggtccggttgttcgggacaagtga

DBGET integrated database retrieval system