KEGG   Propionibacterium acnes SK137: HMPREF0675_3799Help
Entry
HMPREF0675_3799   CDS       T01215                                 

Definition
ribonuclease
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
pak  Propionibacterium acnes SK137
Brite
Enzymes [BR:pak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     HMPREF0675_3799
Transfer RNA biogenesis [BR:pak03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    HMPREF0675_3799
 Prokaryotic Type
    HMPREF0675_3799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
820038..820481
Genome map
AA seq 147 aa AA seqDB search
MTVATWFRSHRWSVWIVTLLAAVVVGCSAPGNVAAAGSNATTAPMTVMATTQSSVGLVTI
QENELPTQARQTLKLIDSGGPFPFSRDGIVYHNNSGALPHHKDGWYHEYTVATPGAQGRG
PRRIVCGSDSTCFWTPDHYSTFKRIIR
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgcaacctggtttcggtctcaccggtggtccgtctggattgtgaccttgcta
gcagctgtcgtcgtaggctgttcagcgcccggtaatgtagctgcggcaggctcgaacgcg
accacggcccccatgaccgtcatggccaccacacagtcgtctgttgggctggtcaccatc
caggaaaacgagctgcctacccaggctcggcagactctcaagctcattgactccggcggg
ccttttccgttcagccgggacggaattgtctatcacaacaacagtggcgcactacctcat
cacaaggacggctggtaccacgagtacaccgtcgccactcctggagcgcagggtcgagga
ccgcgtcgcatcgtgtgcggttcagactccacctgtttttggacgccggaccattactca
acgtttaagaggatcatccgatga

DBGET integrated database retrieval system