KEGG   Propionibacterium acnes SK137: HMPREF0675_3883Help
Entry
HMPREF0675_3883   CDS       T01215                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pak  Propionibacterium acnes SK137
Pathway
pak00010  Glycolysis / Gluconeogenesis
pak00051  Fructose and mannose metabolism
pak00562  Inositol phosphate metabolism
pak01100  Metabolic pathways
pak01110  Biosynthesis of secondary metabolites
pak01120  Microbial metabolism in diverse environments
pak01130  Biosynthesis of antibiotics
pak01200  Carbon metabolism
pak01230  Biosynthesis of amino acids
Module
pak_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pak_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0675_3883 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF0675_3883 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF0675_3883 (tpiA)
Enzymes [BR:pak01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0675_3883 (tpiA)
Exosome [BR:pak04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0675_3883 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF0675_3883 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF0675_3883 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADE01219
UniProt: D4HCY8
Position
916306..917085
Genome map
AA seq 259 aa AA seqDB search
MSRTPIMAGNWKMNLDHVAATSLVQDLGEALKAAGYDSSKSEAVVIPPFTDIRPVAIIID
GDKLPIAYGAQDISAHDDGAYTGEVSGAMLSKLGCRYVVVGHSERREYHNESDELVNAKA
KKVIENGMTPIICCGEALEVRKAGKHVEHTVGQIKADLDGISAEQVAKLVIAYEPIWAIG
TGETATADDAQEVCQAIREAVKELYDAPTAEAVRIQYGGSVKPANVAEIMAKPDVDGALV
GGASLKAGDFSKIVTFYEA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaccccgatcatggccggcaactggaagatgaacctcgaccacgttgctgct
acctccctcgtccaggatctcggtgaggccctcaaggccgcgggatacgactcctccaag
tcggaggccgtcgtcatcccgccgttcaccgatatccgtcctgttgccatcatcattgat
ggcgacaagttgccgatcgcctacggtgcccaggatatttcggctcacgacgatggcgct
tacaccggcgaggtgtccggcgccatgctgtcgaagctgggttgccgctatgtcgtcgtt
ggccactccgagcgtcgcgagtaccacaacgagtccgacgaactggtcaatgccaaggct
aagaaggtcatcgaaaatggaatgaccccaatcatctgctgtggcgaggccctcgaggtt
cgcaaggctggcaagcacgtcgaacataccgttggccagatcaaagccgaccttgacggc
atttctgccgagcaggtcgccaagcttgtcattgcctacgagcccatctgggccatcggc
actggcgagactgccaccgctgacgatgcccaggaggtctgccaggccatccgcgaggcc
gtcaaggagctttacgacgccccgaccgccgaggcggtgcgcattcagtacggtggttca
gttaaaccggccaacgtcgctgagatcatggccaagccagacgttgacggcgctctcgtt
ggcggagcctcgctcaaagctggcgatttctccaagattgtaactttctacgaggcctga

DBGET integrated database retrieval system