KEGG   Propionibacterium acnes SK137: HMPREF0675_3968Help
Entry
HMPREF0675_3968   CDS       T01215                                 

Definition
putative Acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pak  Propionibacterium acnes SK137
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pak01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pak00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pak00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pak00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pak00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
992842..993624
Genome map
AA seq 260 aa AA seqDB search
MRKHDLSSLRVLGSVGESINPEAWRWFHDVVGDGTCPITDTWWQTETGMFQITTVPSMPL
KPGAVGRPVFGQEAAVVDEEGHELPAGKEGFLVLKNPWPAMMRTLYKDPDRYLEAYWTKY
PGVYLTGDSARIDDDGYIWIIGRADDVIKVSGHRIGTAEVESALIFHPAVAEAAAIGLPH
EVKRNAIHMVVVLNHSFEPTKNLVSDIRGHVAETLSPIAKPDTIEFVDKLPKTRSGKIVR
RVLKARVLGGDEGDLSTLED
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaacacgatctgtccagtttgcgcgtactcggttcggttggcgagtccatcaac
ccggaggcttggcgctggttccacgacgtggtcggtgacggcacgtgtccgatcaccgat
acctggtggcagaccgaaactggcatgttccagatcaccactgtgccgtcgatgccgctc
aaaccaggtgccgttgggcgtccggtctttggccaggaggctgctgttgtcgacgaggag
ggccatgagctccctgcgggcaaagagggcttcctcgtcctcaaaaacccgtggccggcc
atgatgcgcaccctgtataaggatccggatcgatacctcgaggcgtactggacgaagtac
ccgggtgtctatctcaccggtgattccgcacgaatcgatgatgacggctacatatggatc
atcggacgtgctgacgacgtcatcaaggtatccggtcaccgcatcggtactgctgaggtg
gagtccgctctgatctttcaccccgccgtcgccgaggctgcggccatagggctgcctcac
gaagtgaagcgcaacgcgatccatatggtcgttgtactcaatcatagtttcgagccgacg
aagaatctcgtctctgatatccgcggacacgtcgccgaaaccctctcgccgattgccaag
cctgacaccatcgagttcgtcgacaagttgccgaagacccgctccggcaagatcgtgcgt
cgcgtcctcaaagctcgtgtcctgggtggagacgagggagacctgtcaaccctagaggac
tga

DBGET integrated database retrieval system