KEGG   Propionibacterium acnes SK137: HMPREF0675_4193Help
Entry
HMPREF0675_4193   CDS       T01215                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pak  Propionibacterium acnes SK137
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0675_4193 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0675_4193 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0675_4193 (trpB)
Enzymes [BR:pak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0675_4193 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1229398..1230669
Genome map
AA seq 423 aa AA seqDB search
MERTIMSARDLPDARGHFDRFGGRFVPEALQAALSQLTGTFEAAVTDPDFLTELEDLRRE
YAGRPSPLTEAPRFSQYIFQQTGHQVRVLLKREDLNHTGSHKINNVLGQALLTRKMGKRR
LIAETGAGQHGVATATVAAMMGMECRIYMGQIDTERQALNVARMQLLGAEVIAVEAGSRT
LKDAMNEAMRDWVAHVEDTHYLIGTASGPHPFPKLVREFQRVISAEARQQCLDRVGRLPD
AICACVGGGSNAIGSFAEFIDDPEVRLYGFEAGGDGVETGRHAASITRGSVGVLHGTRTY
ILQDPDGQTMESHSISAGLDYPGAGPEHSWLAARKRATYLPVNDREAMEALRTLTRTEGI
MPAIESAHAVAGVLKIAKDLPAHDGEPSVVIVTVSGRGDKDVDTALKWFAMDGSVDATTG
GME
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggacgatcatgtccgcacgagacttgcccgacgctcggggacacttcgaccgt
ttcggtggccgattcgttccagaagctctccaagctgctcttagccagcttacggggacc
ttcgaggccgcggtaaccgatcctgactttctcactgagctggaggatctgcgccgggag
tacgccggacgcccctctccgcttacagaggcaccgcgattttctcaatacatctttcaa
cagaccggtcatcaggtgcgagtccttctgaagcgcgaggacctgaaccacaccggttct
cacaagatcaacaatgtgttgggtcaagccctgctgactcgaaagatgggcaagcgccgt
ctcattgcggagacgggagctggacagcatggcgtggcgacggcaaccgtggccgcgatg
atgggcatggagtgccggatctatatgggccagatcgacactgagcgtcaggccctcaat
gtggctcgcatgcagctgttgggcgccgaggtcattgcagtggaagccggctcgcgcacg
ttgaaggacgccatgaacgaggccatgcgagattgggtggcccatgttgaggacacccac
tacctcatcggtaccgcttctgggccacacccgttccctaaactggtgcgagagtttcag
cgggtcatttctgcggaggcccgtcagcagtgccttgatcgggttggacgccttcccgac
gccatttgtgcgtgtgtcggtggtgggtcgaatgccatcggatcgttcgccgagttcatc
gacgaccccgaggttcgtctctacggtttcgaggcgggcggtgacggtgtcgagaccggt
cgccatgcagcatcgatcaccaggggttccgttggtgtactgcacggcactcgcacctac
attctgcaagatccggacggccagacgatggaatctcactccatatcggccggcctggac
tatcccggagctggccccgaacattcttggttagcggcccggaagcgtgctacttacctc
ccggtcaacgaccgcgaggccatggaggctctacgtaccctcacccgcaccgaaggcatc
atgccggccattgagtcggcccacgctgtcgccggcgttcttaagatcgcgaaagacctg
cctgctcacgacggcgagccgtcagtggtcatcgtcacggtgtcgggtcgcggggataaa
gatgttgacactgccctgaagtggtttgccatggacggcagcgtcgacgccactacggga
ggtatggaatga

DBGET integrated database retrieval system