KEGG   Propionibacterium acnes SK137: HMPREF0675_4193Help
Entry
HMPREF0675_4193   CDS       T01215                                 

Gene name
trpB
Definition
tryptophan synthase, beta subunit (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pak  Propionibacterium acnes SK137
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pak01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pak00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pak00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1229398..1230669
Genome map
AA seq 423 aa AA seqDB search
MERTIMSARDLPDARGHFDRFGGRFVPEALQAALSQLTGTFEAAVTDPDFLTELEDLRRE
YAGRPSPLTEAPRFSQYIFQQTGHQVRVLLKREDLNHTGSHKINNVLGQALLTRKMGKRR
LIAETGAGQHGVATATVAAMMGMECRIYMGQIDTERQALNVARMQLLGAEVIAVEAGSRT
LKDAMNEAMRDWVAHVEDTHYLIGTASGPHPFPKLVREFQRVISAEARQQCLDRVGRLPD
AICACVGGGSNAIGSFAEFIDDPEVRLYGFEAGGDGVETGRHAASITRGSVGVLHGTRTY
ILQDPDGQTMESHSISAGLDYPGAGPEHSWLAARKRATYLPVNDREAMEALRTLTRTEGI
MPAIESAHAVAGVLKIAKDLPAHDGEPSVVIVTVSGRGDKDVDTALKWFAMDGSVDATTG
GME
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggacgatcatgtccgcacgagacttgcccgacgctcggggacacttcgaccgt
ttcggtggccgattcgttccagaagctctccaagctgctcttagccagcttacggggacc
ttcgaggccgcggtaaccgatcctgactttctcactgagctggaggatctgcgccgggag
tacgccggacgcccctctccgcttacagaggcaccgcgattttctcaatacatctttcaa
cagaccggtcatcaggtgcgagtccttctgaagcgcgaggacctgaaccacaccggttct
cacaagatcaacaatgtgttgggtcaagccctgctgactcgaaagatgggcaagcgccgt
ctcattgcggagacgggagctggacagcatggcgtggcgacggcaaccgtggccgcgatg
atgggcatggagtgccggatctatatgggccagatcgacactgagcgtcaggccctcaat
gtggctcgcatgcagctgttgggcgccgaggtcattgcagtggaagccggctcgcgcacg
ttgaaggacgccatgaacgaggccatgcgagattgggtggcccatgttgaggacacccac
tacctcatcggtaccgcttctgggccacacccgttccctaaactggtgcgagagtttcag
cgggtcatttctgcggaggcccgtcagcagtgccttgatcgggttggacgccttcccgac
gccatttgtgcgtgtgtcggtggtgggtcgaatgccatcggatcgttcgccgagttcatc
gacgaccccgaggttcgtctctacggtttcgaggcgggcggtgacggtgtcgagaccggt
cgccatgcagcatcgatcaccaggggttccgttggtgtactgcacggcactcgcacctac
attctgcaagatccggacggccagacgatggaatctcactccatatcggccggcctggac
tatcccggagctggccccgaacattcttggttagcggcccggaagcgtgctacttacctc
ccggtcaacgaccgcgaggccatggaggctctacgtaccctcacccgcaccgaaggcatc
atgccggccattgagtcggcccacgctgtcgccggcgttcttaagatcgcgaaagacctg
cctgctcacgacggcgagccgtcagtggtcatcgtcacggtgtcgggtcgcggggataaa
gatgttgacactgccctgaagtggtttgccatggacggcagcgtcgacgccactacggga
ggtatggaatga

DBGET integrated database retrieval system