KEGG   Propionibacterium acnes SK137: HMPREF0675_4194Help
Entry
HMPREF0675_4194   CDS       T01215                                 

Definition
(GenBank) putative Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pak  Propionibacterium acnes SK137
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0675_4194
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0675_4194
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0675_4194
Enzymes [BR:pak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0675_4194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1230666..1231163
Genome map
AA seq 165 aa AA seqDB search
MTGSASVYLRAHQENRPALVGYFPVGHPSVPHSIDAMKALTTGTTGTGVDLVVIGMPYSD
PMMDGTVIQHVTTGALERGVRTRDTLLATEAVAGTGTPCVIMTYWNLVAHYGVDAYARDL
ASAGGSGLTTPDEAEDRGDSVTVGIDRMCAIVDDLAAGVRRAERQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtagcgccagtgtctacctcagggcccaccaagagaaccgcccggccctcgtc
ggttacttcccggtgggacacccgtcagttcctcactcgatcgatgctatgaaggcactg
actacgggcactactgggaccggtgtcgacctcgtcgtgatcggaatgccttactccgac
ccgatgatggacggcaccgtcattcagcacgtcactaccggggctctagagcgcggggta
cgcactcgcgacaccctattggccacagaggccgtggccgggaccggaactccgtgcgtg
attatgacctattggaaccttgtcgcgcactacggtgtcgacgcttatgctcgcgatctg
gcatccgcgggtggctcagggctcaccacccccgatgaggctgaggatcggggggactca
gtgacggtaggaattgaccggatgtgcgccatcgtcgacgacctggcggccggagtacgg
cgggcggaacgccagtga

DBGET integrated database retrieval system