KEGG   Propionibacterium acnes SK137: HMPREF0675_4252Help
Entry
HMPREF0675_4252   CDS       T01215                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pak  Propionibacterium acnes SK137
Pathway
pak00230  Purine metabolism
pak01100  Metabolic pathways
Module
pak_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HMPREF0675_4252 (gmk)
Enzymes [BR:pak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HMPREF0675_4252 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 ABATE AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADD99934
UniProt: D4HDZ8
Position
1298423..1299022
Genome map
AA seq 199 aa AA seqDB search
MSSVPVIPQARGLRHTGPVTVAVVSGPTAVGKGTVVGALLRSHPEIVVSRSVTTRPPRPT
ERDGIDYDFITPEQFDKLVDGEGLLEWATVHNSHRYGTPRGPVERAVADNRTVVLEIDLQ
GARQVRETYPQATQIFLAPPSWEELVHRLIGRGTETPEQQKQRLETAKVELANADEFDAV
VVNDTVDHAVAHLVELLSL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtccccgtcatccctcaggcccgagggcttcgtcacaccggcccggtcacc
gtggctgtcgtctccggacctaccgcagttggtaaagggaccgtggtaggggcgctgctg
cgtagccatccggagatcgtcgtttccaggtcggtgactacccgtccgccgcgccccact
gaacgcgatgggatcgattacgacttcatcacccctgagcagttcgacaagctcgttgac
ggcgagggtctccttgagtgggcaaccgtccataacagccaccggtacggcacaccgcgc
ggtcctgttgaacgggcagttgctgacaatcgcacggtcgtgctggaaatcgatctgcag
ggagctcgccaagttcgcgaaacctatcctcaggcgacccagatcttcctcgcgccaccc
tcatgggaggagctagtccaccgtctgatcggtcgcggcacggaaacaccagagcaacag
aagcagcgtctggagactgcaaaggttgagctggccaacgcggatgaatttgacgccgtt
gtcgtcaacgacaccgtagatcacgcagttgcgcatctggtagaattactaagtctgtga

DBGET integrated database retrieval system