KEGG   Propionibacterium acnes SK137: HMPREF0675_4276Help
Entry
HMPREF0675_4276   CDS       T01215                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pak  Propionibacterium acnes SK137
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0675_4276 (rbsK)
Enzymes [BR:pak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HMPREF0675_4276 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1321811..1322725)
Genome map
AA seq 304 aa AA seqDB search
MDIAVVGSNMVDLISYIHRMPSDGETVEAPEFRMGCGGKGANQAVAASRLGAEVVMVTRV
GNDVFADTTLDNFRKNGIDTTHVLRTDASSGVAPIFVDPESRNSILIIKGANAQLSPADV
EGARQDIATCKLIMLQLEIPLETVYATIELGDVLGIPILLNPAPVAPELDLERIRGIEFF
MPNESELELITGMPVDTLDDIGKATDVLLGAGITNIIVTLGSRGAMWAHAEGRKIIKAPV
VQAVDTTGAGDAFIGCFAKEWVDHGDVIAAIRAGNRYAADSVTRHGTQSSYALADGSLPE
WLRS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgccgttgttgggtccaatatggtggacctcatctcctacattcatcgcatg
ccatcagacggtgaaaccgtcgaggctcccgaattccgaatgggatgcggcggcaaaggt
gcgaatcaggcagtagctgcgtcacgtctcggtgcagaggtcgtgatggtcacccgagtg
ggcaacgatgtgttcgccgacaccacgttggacaactttcgcaaaaacggtatcgatact
acccatgtgttgcgtaccgatgcgagctccggggtggcaccgatcttcgtcgatccagaa
tcgcgtaactccatcctcatcatcaagggagctaacgctcagctgagtcctgctgatgtc
gagggtgcccgacaagacattgccacgtgcaaactcatcatgctgcagctggagattccg
ttggagacggtctacgccacgattgagttaggggacgtactggggatcccaatactcctc
aatccggctccggtcgcaccagaattggatcttgagcgaatccgcggaattgagttcttc
atgccgaacgagtccgagcttgaactcataacggggatgccagtagacaccctcgatgat
atcggcaaggctactgatgtgctgctgggagcgggcatcacgaatatcatcgtaactttg
ggctcgcgtggtgcgatgtgggcccacgcagaaggacgcaaaatcatcaaggccccggtt
gttcaagccgtggacacgacaggtgctggcgatgccttcataggctgctttgctaaagaa
tgggtagatcacggcgacgtgatagctgcgattcgtgcaggaaacaggtatgcggctgac
tcggtcacacgccacggaactcagagctcgtatgccttggccgatggaagtctcccggag
tggctgagatcatag

DBGET integrated database retrieval system