KEGG   Propionibacterium acnes SK137: HMPREF0675_4320Help
Entry
HMPREF0675_4320   CDS       T01215                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pak  Propionibacterium acnes SK137
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0675_4320 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0675_4320 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF0675_4320 (thrC)
Enzymes [BR:pak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF0675_4320 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1362699..1363775)
Genome map
AA seq 358 aa AA seqDB search
MIMSQQNRLFGVIETYRDRLPMDGIDQIVTLGEGATPLVPAPRLGAELDATVWVKVEGAN
PTGSFKDRGMTMAMTKALADGSKAVVCASTGNTSASASAYASRAGMTPVVLLPQGKIAAG
KLAQAVVHGGRIIQILGNFDDCLRIARELAENFPVSLVNSINPYRIEGQKTAAFEVVDVL
GDAPDIHALPVGNAGNITAYWKGYREYVADGPASHTPRMFGFQAAGAAPLVLGHDVNDPE
TVATAIRIGRPASGKLALAARDESEGLIDAVTDEQILDAQTFLAAREGIFVEPASAVGVA
GLFKLKSEGRLDPGLRIVVTVTGNGLKDIDTALSRTTLSTEAVEASTDQVAALLDFCS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatgagccagcagaatcgtctcttcggcgtgattgagacctatcgagaccgtctc
cctatggacggaattgaccagatcgtgacgttgggggagggggcgaccccgttggtgcct
gccccacgattgggcgccgagcttgacgcgacggtatgggttaaagttgaaggggccaat
ccgaccggatcgttcaaggatcgtggcatgacgatggccatgacgaaagcccttgccgac
ggctcgaaagccgtggtgtgtgcctctaccggtaatacctctgcctcggcatcggcttac
gcctcccgagccggcatgactccggtcgtgctccttccccagggcaagattgcagctggc
aaactcgcccaggctgttgtccatggcggtcgaatcatccagattctcggcaacttcgac
gattgcctgcgtattgcccgcgagctggccgagaatttcccggtctccctggtgaactcg
atcaatccgtaccgcatcgagggacagaaaactgctgcctttgaggtcgttgacgttctt
ggtgacgctcctgatatccacgctcttccggtgggcaacgcaggcaatatcaccgcctat
tggaagggttaccgcgagtacgtagcggacggtcctgccagccacacgccgcggatgttc
ggattccaagccgctggcgcagcccccctggtgctgggccacgacgttaatgacccggaa
acggtagccaccgctattcgtatcggtcgtccggcctccggcaagctggcgttggccgct
cgagacgagtcggaggggctcatcgacgctgtcacggacgagcaaattcttgacgcccag
actttcctagctgctcgagagggcatttttgttgagccggcatcagcagtcggagtggca
ggtttgttcaagttgaagtccgagggacgcctggatcctggactgcgcatcgtcgtcacg
gtaactggaaacggtctgaaggacattgacactgcattgagtcgcactaccttgtcaacc
gaggctgtggaagcttcgactgaccaggttgccgctttgttggacttctgttcctga

DBGET integrated database retrieval system