KEGG   Propionibacterium acnes SK137: HMPREF0675_4357Help
Entry
HMPREF0675_4357   CDS       T01215                                 

Gene name
recD
Definition
exodeoxyribonuclease V, alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pak  Propionibacterium acnes SK137
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pak03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1406438..1408324
Genome map
AA seq 628 aa AA seqDB search
MTDLVPVAAGSRLEPFARAGVLEASDIHLANLVCRIGGETNCDVSLAIALSCRELRRRSV
FWDPHEIANVVRQQILDPAIPDIETSDQAALFAELEWPPPGEWLSTLEASPVIAGRDDPL
NRLPARLDDGLVYLEKYWQAEHDVARDLATLAADPPSQGPVSADDVVSSISNALAASGIM
LDPAQADAAIAAIMHRVSVLAGGPGTGKTTTVCALLAALQQADPHLGAVALAAPSGKAAA
RLRDSVSQVSERMPDDLKPIVADATTVHSLLKWQGPGTSFGYDEQHKLPFGVVVVDEASM
LSLPLAASLLSAIGPQTRLILVGDPGQLVSVDAGSVLADIVSSADALQAQLPVTILTCNH
RSRGDIARLSEAVREGDKSTALDVLATAAGVTHDSPSPDSIATISGRRSITWIDVDPASI
TMADLPAVAEVIARTGARMLELAQASADAAALKLVDAHRLLCAHREGPYGVDEWSQRMVT
VLSDVLPGVGQGRWVLGETAIVTHNLAQLGVNNGDCGVIVETRPVPTIALPGPGGVPRRL
PCSLIPSLQPLQAMTIHKAQGSQFTDVTVVLPPPDSPLLSRELLYTAITRAREHLTVVGT
RESVERAIDRANDRRSGIQRRWEESRTS
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgactgacctcgtcccggtagcagcaggaagtcggctcgagcccttcgcccgagccgga
gtcctcgaggccagcgacatccatttagccaatctagtgtgccgcatcggtggcgagacc
aactgcgatgtcagcctcgccatcgctttatcatgccgtgagcttcggcgcaggtccgtg
ttctgggacccacatgaaatcgcaaacgtcgtccgccagcaaatccttgatccggcaatt
ccagacatcgaaaccagcgaccaggcagccctattcgcggaattggaatggccacctcca
ggcgagtggctgtccacgctagaggccagtcccgtcattgctggccgtgatgatccgctc
aaccggttgccggctcggcttgatgatggcctggtctacctagagaaatattggcaagct
gagcatgatgtcgcccgcgatctcgctaccctcgctgcggatccgccaagccaaggccca
gtgtcggccgacgatgttgtttccagcatcagtaatgccttagcagcatccggaattatg
ttggatccagctcaagctgatgctgccatcgccgcaattatgcaccgagttagtgtgctt
gcaggtggccccggaaccggcaagacaactacggtatgcgccctcctagctgccttgcaa
caggctgaccctcatcttggagccgtggcccttgcggctcccagcggcaaagcagcggca
cgcttgcgtgactcagtttcgcaagtttcagagcgaatgcccgatgacctgaaaccgatt
gttgctgacgcaactaccgtccactcactgctgaaatggcaggggccgggaacctcattc
ggatatgacgagcaacacaagcttccgttcggagtcgtcgtcgttgacgaagcatcaatg
ctttctctgcctctggccgctagcctcctctctgcaatcgggcctcaaactcgtctaatt
ctcgtcggggacccagggcagcttgtctcggtggacgccggtagtgtcctggccgacatc
gtttcgtcggctgatgccctccaagcgcagcttcctgtcacgatcctcacctgtaaccac
cgctcgagaggagatatcgcacggctgtcggaggcggtacgcgagggagacaagagcact
gcgttggacgtattggcgacagctgctggcgtgacacatgactctccttcccccgatagc
atcgcgacgatcagtggtcgtcgcagtattacgtggatcgacgttgacccggcgagtatc
accatggccgaccttccggcggtcgcggaggtgatcgcacgcaccggggcaagaatgctt
gagcttgctcaggctagtgccgacgctgctgctctcaaactcgtcgatgcccaccggttg
ttgtgcgctcaccgagaggggccatacggggtagacgagtggtctcagcgcatggttact
gtactttcagatgtgttgcctggtgttggccaaggccggtgggttctcggcgaaactgca
atagtaacgcataacctcgcacaattgggagtcaataacggcgattgcggggtcatcgtt
gaaacaaggcccgtccccacgatagctctaccgggacccggtggagtccccagacggttg
ccctgttccctcatcccatcgctgcaacccttacaggcgatgacgattcacaaagcgcag
ggcagccaattcacggacgtaacggtggtcctgccaccacccgactcgcccctcctctct
cgtgagttgctctataccgccatcacgcgtgcacgtgaacacctcactgtggtgggcaca
agggagtctgtggagagggcgattgaccgggctaatgatcgacgttctgggattcagcgc
cggtgggaagaaagtcgcacttcctga

DBGET integrated database retrieval system