KEGG   Propionibacterium acnes SK137: HMPREF0675_4507Help
Entry
HMPREF0675_4507   CDS       T01215                                 

Gene name
mutM
Definition
DNA-formamidopyrimidine glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pak  Propionibacterium acnes SK137
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pak03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1544587..1545357)
Genome map
AA seq 256 aa AA seqDB search
MLELPEVETVRAGLEQFVVPVVVDSVDVVDTRGLRPSGGLEDAALFETTLSGRQFTAVNR
RGKYLWFILDDGTAMLAHLGMSGQFRVSTQHAPQHRHTRIVITLDDGRDLRFLDQRTFGG
LTLAPLVDGIPGPVTHIAPDPFEECFDVDEVVRRLCARRSAIKRSLLDQTLVSGIGNIYA
DETLWRVRCHPETPCSRLSQSEAVELLQTACDVMAEAMSQGGTSFDSLYVNVNGESGWFS
RVLDAYGREDEPLPPM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgagctccccgaggtcgagaccgttcgagccggactcgaacagttcgttgttccg
gttgtcgtcgacagcgtcgacgttgtcgatactcgcgggcttcgccccagcggtggactc
gaggacgctgcgcttttcgagacgaccttgtcgggtcgtcaatttactgccgtaaatcgc
cggggtaagtacctgtggttcatccttgacgatggcaccgcgatgttggctcatctaggt
atgagcggacaattccgtgttagcacccaacatgccccgcagcatcgccatacccgtata
gtcatcaccctcgacgatggtcgtgacctgcgcttcctcgaccagcgcaccttcggcgga
ttgaccctagccccgctcgttgatggtattcccggtccggtgacccacatcgcccctgat
ccgttcgaggagtgtttcgacgttgacgaggtagtgcgacggttgtgcgcacgcaggtcc
gccattaagaggagtttgctcgatcaaacccttgtttccgggattggcaatatctatgcc
gacgaaactctttggcgggtccgttgtcaccccgagacaccatgctctcgcctgagtcaa
tccgaagcggtggaattgttgcagacggcctgcgatgttatggcagaggccatgtctcag
ggcggtacctctttcgactctctttatgtcaacgtcaacggggaatcggggtggttttcc
cgtgttttggatgcctacggccgtgaggatgagcccctgccaccgatgtga

DBGET integrated database retrieval system