KEGG   Propionibacterium acnes SK137: HMPREF0675_4661Help
Entry
HMPREF0675_4661   CDS       T01215                                 

Definition
(GenBank) ribose 5-phosphate isomerase
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
pak  Propionibacterium acnes SK137
Pathway
pak00030  Pentose phosphate pathway
pak00051  Fructose and mannose metabolism
pak01100  Metabolic pathways
pak01110  Biosynthesis of secondary metabolites
pak01120  Microbial metabolism in diverse environments
pak01130  Biosynthesis of antibiotics
pak01200  Carbon metabolism
pak01230  Biosynthesis of amino acids
Module
pak_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pak_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0675_4661
   00051 Fructose and mannose metabolism
    HMPREF0675_4661
Enzymes [BR:pak01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     HMPREF0675_4661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB
Motif
Other DBs
NCBI-ProteinID: ADE00089
UniProt: D4HFK5
Position
complement(1715654..1716127)
Genome map
AA seq 157 aa AA seqDB search
MTFKPSHVHIGTDHAAFELKEYLVGKLTEAGYQVVDHGAASYDSQDDYPDYCIPCAQAVM
ADPGSLGIVLGGSGNGEQIAANKVKGIRAALAYTVEIAELARLHNNANVVSLGGRMQTQE
EAWQIVETFLTTDFSHEDRHQRRIDKLIRWEDKGSLG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacctttaagccttcacatgttcatatcggcaccgaccatgcggcctttgagcttaag
gagtacctcgttggcaagttgaccgaagctggataccaggtcgtcgatcatggtgcggct
agctatgactctcaggatgactatcccgactactgcatcccgtgtgctcaggccgtgatg
gccgacccggggtcgcttggcatcgtgctgggtggttccggcaacggagagcagatcgct
gcgaacaaggtcaaggggattcgcgccgcactggcgtacaccgtcgagatcgcggaactg
gcacgtctccacaacaatgcgaacgttgtctctttgggtggccggatgcagactcaggag
gaagcctggcagatcgtcgaaactttcctgacgaccgatttctcccacgaggaccgccac
cagcgtcgtattgacaagctcattcgctgggaggacaagggctcactggggtga

DBGET integrated database retrieval system