KEGG   Propionibacterium acnes SK137: HMPREF0675_4661Help
Entry
HMPREF0675_4661   CDS       T01215                                 

Definition
ribose 5-phosphate isomerase (EC:5.3.1.6)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
pak  Propionibacterium acnes SK137
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:pak01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pak01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pak00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pak00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1715654..1716127)
Genome map
AA seq 157 aa AA seqDB search
MTFKPSHVHIGTDHAAFELKEYLVGKLTEAGYQVVDHGAASYDSQDDYPDYCIPCAQAVM
ADPGSLGIVLGGSGNGEQIAANKVKGIRAALAYTVEIAELARLHNNANVVSLGGRMQTQE
EAWQIVETFLTTDFSHEDRHQRRIDKLIRWEDKGSLG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacctttaagccttcacatgttcatatcggcaccgaccatgcggcctttgagcttaag
gagtacctcgttggcaagttgaccgaagctggataccaggtcgtcgatcatggtgcggct
agctatgactctcaggatgactatcccgactactgcatcccgtgtgctcaggccgtgatg
gccgacccggggtcgcttggcatcgtgctgggtggttccggcaacggagagcagatcgct
gcgaacaaggtcaaggggattcgcgccgcactggcgtacaccgtcgagatcgcggaactg
gcacgtctccacaacaatgcgaacgttgtctctttgggtggccggatgcagactcaggag
gaagcctggcagatcgtcgaaactttcctgacgaccgatttctcccacgaggaccgccac
cagcgtcgtattgacaagctcattcgctgggaggacaagggctcactggggtga

DBGET integrated database retrieval system