KEGG   Propionibacterium acnes SK137: HMPREF0675_4687Help
Entry
HMPREF0675_4687   CDS       T01215                                 

Definition
glycosyl hydrolase family 3 N-terminal domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pak  Propionibacterium acnes SK137
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pak00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pak00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1746571..1747809
Genome map
AA seq 412 aa AA seqDB search
MRRRTIIAAGLSMPLTGCVSQDSQPKEPPSTTVTASPTPSGTSTSSSASPTSAPSHASTA
TSRPTPIRMNLRAVEIAKKLSPEQRAGQCILVGVVPSDSPEYITNLIDTQCLAGIFLLGH
WTSRSKLEAMLSAVNHVSPQGIKPIVATDHEGGEIQNIRVPGVDHLPSQEALARMSPAKV
QAVVTTGARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVV
AGHRKAGIISTTKHFPGIGRITEDTDFKSAGITDDKTTRHDRYLESFRMAFDAGSEAVMI
ASAYYSKIDPGTLGLFSSKIMTDMLRGDFGYQGLIVSDDLGSSVSVFSVDGGHRASKFVS
AGGDLAITADPLLAGPMIRALTSTATSASGKKRLVDAASHVINVKLAHSLTK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagacggcgaacaatcatcgcagccggtttgagcatgccgcttactggatgcgtctct
caagattcccagcccaaggagccaccgtccaccacggttacggcatcaccgactccttct
ggcacctcgacgtcatcctcggcaagcccgacgtcggctccatctcacgcctcaacggct
acctccaggccgaccccaatccgcatgaatctgcgagctgtcgaaatcgccaagaaattg
tctcccgagcaacgcgccggccaatgcattcttgtcggcgtagtgccatcagactccccc
gaatacatcaccaacctcattgacacccagtgcttagccggaatcttcctgctaggacac
tggacgagcaggtccaagcttgaggccatgctcagcgctgttaatcacgtcagcccgcag
ggcatcaaacctattgtcgcaactgaccacgaaggtggcgaaatccagaacatccgggtg
ccaggagtcgatcacctgccgagtcaggaagctctggcccggatgtccccggccaaggtg
caagcagtcgtaacgaccggtgctcgtcaactcgccaaactcggcgtccatatggtcttc
tcccccgtggctggcgtcatcgaccctcgccttggggtacgtaataagccaattgccaag
catcatcgtggtttcggaaccgatccgcacctctgcgggcaatactcggcagccgtcgtt
gcgggacaccgcaaagcggggatcatttcgaccactaagcattttcctggcatcggacgg
atcacggaggatactgacttcaaatccgccgggattactgacgacaagaccacccgccac
gaccgatatcttgagtctttccggatggcctttgacgctggatctgaagccgtcatgatc
gcatccgcgtactactcaaagatcgatcccggcaccctcgggttattttcatcaaagatt
atgacagatatgctgcgcggagacttcggttatcagggactcatcgtgtccgacgacctg
gggagttcagtctcagtattctcagtcgatggtggtcatcgggcaagcaaattcgtctct
gccggcggcgatctagctatcacagctgacccccttctggcaggccccatgattcgcgcg
ttgacgtcgaccgcgacgtccgcgtccggtaagaagcgtcttgttgacgctgctagccat
gtcatcaatgtcaaattggcgcattcattgacgaagtga

DBGET integrated database retrieval system