KEGG   Propionibacterium acnes SK137: HMPREF0675_4687Help
Entry
HMPREF0675_4687   CDS       T01215                                 

Definition
glycosyl hydrolase family 3 N-terminal domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pak  Propionibacterium acnes SK137
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0675_4687
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    HMPREF0675_4687
Enzymes [BR:pak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HMPREF0675_4687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1746571..1747809
Genome map
AA seq 412 aa AA seqDB search
MRRRTIIAAGLSMPLTGCVSQDSQPKEPPSTTVTASPTPSGTSTSSSASPTSAPSHASTA
TSRPTPIRMNLRAVEIAKKLSPEQRAGQCILVGVVPSDSPEYITNLIDTQCLAGIFLLGH
WTSRSKLEAMLSAVNHVSPQGIKPIVATDHEGGEIQNIRVPGVDHLPSQEALARMSPAKV
QAVVTTGARQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVV
AGHRKAGIISTTKHFPGIGRITEDTDFKSAGITDDKTTRHDRYLESFRMAFDAGSEAVMI
ASAYYSKIDPGTLGLFSSKIMTDMLRGDFGYQGLIVSDDLGSSVSVFSVDGGHRASKFVS
AGGDLAITADPLLAGPMIRALTSTATSASGKKRLVDAASHVINVKLAHSLTK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagacggcgaacaatcatcgcagccggtttgagcatgccgcttactggatgcgtctct
caagattcccagcccaaggagccaccgtccaccacggttacggcatcaccgactccttct
ggcacctcgacgtcatcctcggcaagcccgacgtcggctccatctcacgcctcaacggct
acctccaggccgaccccaatccgcatgaatctgcgagctgtcgaaatcgccaagaaattg
tctcccgagcaacgcgccggccaatgcattcttgtcggcgtagtgccatcagactccccc
gaatacatcaccaacctcattgacacccagtgcttagccggaatcttcctgctaggacac
tggacgagcaggtccaagcttgaggccatgctcagcgctgttaatcacgtcagcccgcag
ggcatcaaacctattgtcgcaactgaccacgaaggtggcgaaatccagaacatccgggtg
ccaggagtcgatcacctgccgagtcaggaagctctggcccggatgtccccggccaaggtg
caagcagtcgtaacgaccggtgctcgtcaactcgccaaactcggcgtccatatggtcttc
tcccccgtggctggcgtcatcgaccctcgccttggggtacgtaataagccaattgccaag
catcatcgtggtttcggaaccgatccgcacctctgcgggcaatactcggcagccgtcgtt
gcgggacaccgcaaagcggggatcatttcgaccactaagcattttcctggcatcggacgg
atcacggaggatactgacttcaaatccgccgggattactgacgacaagaccacccgccac
gaccgatatcttgagtctttccggatggcctttgacgctggatctgaagccgtcatgatc
gcatccgcgtactactcaaagatcgatcccggcaccctcgggttattttcatcaaagatt
atgacagatatgctgcgcggagacttcggttatcagggactcatcgtgtccgacgacctg
gggagttcagtctcagtattctcagtcgatggtggtcatcgggcaagcaaattcgtctct
gccggcggcgatctagctatcacagctgacccccttctggcaggccccatgattcgcgcg
ttgacgtcgaccgcgacgtccgcgtccggtaagaagcgtcttgttgacgctgctagccat
gtcatcaatgtcaaattggcgcattcattgacgaagtga

DBGET integrated database retrieval system