KEGG   Propionibacterium acnes SK137: HMPREF0675_4733Help
Entry
HMPREF0675_4733   CDS       T01215                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pak  Propionibacterium acnes SK137
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0675_4733 (malQ)
Enzymes [BR:pak01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     HMPREF0675_4733 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1789266..1791374)
Genome map
AA seq 702 aa AA seqDB search
MSLTDPHLTTLADHFGIARDYYDWKGQHTEVGEATVIAVLDGLGIDASTPERAERACHEV
TNRKWRRVLPGIVVLREGQEGRVDVHVNAGEWVEVHVVCEDGQRRECWQVDNWNPDRHVD
DRWIGEATFGIPGDLPLGYHTIVATTADHRATSTLVVSPNWLGLPRSMGSSRVWGHAVQL
YSTRSRASWGMGDFSDLADLSTWAATQGADYVLVNPLHASQVVSPIEPSPYLPCSRLFLN
PLYVRPEIIPEYADLDVYVRSQARSAWAQAAADAEAIDRDRSWNAKLPVLEAVHALGLEG
SRELSYQAFRRLCGTRLEDLATWCALTEVYGNDWRTWPEEYQRPSNRAVSEFVRAHEERV
DFFMWLQWIADQQLSAAQSAGRDAGMSLGLMCDMAVGVSGAGADAWMLGKLFADGVCVGS
PPDAFNQAGQEWGQPPMRPDILANLAYRPFRDMVRAALRHAGGIRIDHILGLFRLWWVPV
GLGPRMGTYIRYDHEAMVGILALEAHRAGALVVGEDLGTVEPWVRAYLRERGIMGTSVLW
FENGENGNPLPPEQWREYAMSSVTTHDLPPTTGYLAGDHVEVRHELGLLTESLEHERAEV
ARQTATWIAILRERGVLVGDDPSEEDIVLAMHRMLTRTPSKVLNATLTDAVGDRRTQNLP
GTTNEYPNWRVPLSHPDGSPMWLDEVFTDERAARLSHVMNEK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgacagatccccacctgacgaccctggccgatcatttcggcatcgctcgtgat
tattacgactggaagggccagcacaccgaggtcggggaggcgactgttattgctgtcctt
gacggtttgggaattgacgcgtcgactccggaacgtgccgaacgcgcgtgccacgaggtg
actaaccggaagtggcgtcgagtgttgcccggaatcgtggtcctacgtgagggtcaagag
gggcgggttgacgttcacgttaatgcaggggagtgggtggaggttcacgtcgtctgcgag
gacgggcaacgccgcgagtgttggcaggtcgacaattggaaccccgatcgccacgtggac
gatcgttggattggtgaggcgaccttcggtatccctggcgatctgccgttgggctaccac
acgatcgtcgcgacgactgcggaccatcgcgcgacctctacgcttgtagtctccccgaac
tggctcggccttcctcgttcgatgggttcgtctcgggtctggggccatgccgtgcagttg
tattcgactcgctcccgcgcctcctggggaatgggtgatttttccgacctggcggacctg
tctacctgggcggccacccagggtgctgactacgtgctcgtgaatccgctgcatgccagc
caggttgtctcccccatcgagccgtcgccgtatttgccttgcagccgtctcttcctgaac
ccgctgtatgtgcgccccgagatcatcccggagtatgccgacctcgacgtctatgtgcgt
tcccaggcacgctcggcctgggctcaagcagcggccgatgctgaggcaatcgatcgagat
cgttcctggaacgccaaactgccagtgctagaagccgtccatgccctcggtctggaggga
tcgagggaattgtcctaccaggcattccgccggctgtgtggtactcgtttagaagatctc
gcgacgtggtgtgcactgacggaggtatacggcaacgattggcgcacctggcccgaggag
tatcagcgccccagcaaccgtgccgtctcagagttcgtgcgagctcacgaggaacgcgtc
gattttttcatgtggctgcagtggattgctgaccaacagctttcggcggcccaatctgcc
ggacgtgacgccgggatgtcgctgggacttatgtgcgatatggccgtgggtgtttccggt
gccggagccgatgcgtggatgctcgggaagctctttgctgacggtgtctgcgtcgggtcg
ccgcctgatgcttttaatcaggctggacaggagtggggacagcctccgatgcgtcccgac
atcctcgccaatctggcatatcggcctttccgcgacatggtgcgcgccgctttgcgtcac
gccggtggcatccgcatcgaccatattctcggcctgttccggctgtggtgggtacccgtc
ggtctcggcccgcgtatgggtacttacatacggtacgaccacgaagccatggttggtatt
ttggcgctggaggcgcaccgggctggcgcccttgtcgtgggcgaggacctgggaacggta
gagccgtgggtgcgcgcctacttgcgcgagcgcggcatcatgggcacctcggtcctgtgg
ttcgagaatggtgagaatggcaatccgctgcctcctgagcagtggcgcgagtacgccatg
agttcggtcactacccatgatttacctcccactactgggtatctggctggtgatcacgtc
gaggtgcgtcatgagctgggactactcactgaatctctcgagcacgagcgcgctgaggtg
gctcgtcagactgccacctggatcgccatcctgcgtgagcgtggcgtgttggtgggggat
gacccctccgaagaggacatcgtgttagcgatgcatcgcatgcttacccgcaccccgtca
aaggtgctcaatgccaccctgactgacgcggtgggagatcgtcgcactcaaaacttgccg
ggtaccacgaatgaatacccaaactggcgggtccctctcagccatccggatggttccccg
atgtggctggatgaggtatttactgacgagcgggctgcgcgactgtctcacgtcatgaac
gagaagtga

DBGET integrated database retrieval system