KEGG   Propionibacterium acnes SK137: HMPREF0675_4752Help
Entry
HMPREF0675_4752   CDS       T01215                                 

Definition
beta galactosidase small chain
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pak  Propionibacterium acnes SK137
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF0675_4752
  Lipid metabolism
   00600 Sphingolipid metabolism
    HMPREF0675_4752
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF0675_4752
Enzymes [BR:pak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HMPREF0675_4752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1807044..1810001
Genome map
AA seq 985 aa AA seqDB search
MVANADTAHRLDDALTNLIPWHGPVAPRAHLHTDAPTLDLSGTWRFQLVDSPHDTPAGFP
DPQFDDTDFVDLAVPSSWHMVDPAGNAPFGRPAYLNTNYPIPVPASDEDIVVPNENPTGC
YRHTFEVGKDFTDAERVLLRFEGVDSFARVWFNGVELGWTKGSRLTSEFDVTSQLRPGRN
VLAVAVSQWSDGTFLEDQDMWRMSGIFREVTLLARPHGGIDDLFVHASWDGDAKLLIDGP
EGATVAIPELELATTCNTEVAIPDAQPWTAETPKLYDATVSTDTETVTIRIGFRSVAIAG
DIITVNGEKIVFRGVNRHEWHPRTGRTLDEQTMRADLELMKRHGVNAIRTSHYPPNARFL
DLCDEYGVWVLLECDLETHGFERGGWDGNPTNDDRWYDCLLNRIQRTVERDKNHPAIIGW
SMGNESHCGEGIRLMNDWVKNRDPSRFTHYEGDDAHTICDVWTVMYPSMEWVEAVRDRTV
MPGAEPAPQTGRELGLPFFMCEFAHAMGNGPGELDAYEERCFDPHFHRDRMHGGFIWEWI
DHGIDTGRGYAYGGDFGEVLHDSNFVCDGLVLPDRTPSPGLLEFTATMGAVRIEVDGEQL
RDGNGITVINRRDFSDLSDLTFVWQLVNDDEYVQTGVLEVGALAAHQIWTGTVPLPDEIS
DRMVVVVEAKLVKDTIWAPAGHVVARTSALLVPKPGPRLYLPASSQSHRDGTGWSLGPAH
FDRRGRLVTWGNANLVAPVLDLFRAPIDNDRASSLARNTIGDAALAAGLDRLVHTTTSVR
DEGDELVVVTRSAAAAARNSMTTTWSWRAIQTNDGSEGVHLDLHVDPHGYWPTMLGRIGV
TIGLPAEWTTVSWFGLGPTENYPDSQHAAIWGRWNGEVDDLQTPYVMPQENGLRQGVHEL
TISGSNGGLRITADGSWPAFAARPWTSQALRTAAHTWDLKPDGHTWLTLDAVSAPLGSTS
CGPMPIMSHRLYAQPVDLSLTLSLI
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atggttgccaatgccgacaccgcacacaggctcgacgatgctctgacgaaccttattccc
tggcacggtccggtagctccccgagctcacctgcataccgacgcccccaccctcgacttg
tctggaacctggcggtttcagctagtcgactcaccccacgacacaccggctggcttcccc
gatcctcagttcgacgacaccgatttcgtcgacctcgccgtgccgtcctcctggcacatg
gtcgacccagccggaaacgcgccctttggccgtccggcttacctcaacaccaactacccc
atcccggttcccgcctcagacgaggacatcgtcgttcccaatgagaaccccaccgggtgc
taccgccacaccttcgaggtcggaaaagacttcaccgacgccgagcgagtgctgctgcgc
ttcgagggcgtcgattcctttgcccgtgtttggttcaacggggtcgaactgggatggacc
aagggttcgcgtctcaccagcgaattcgacgtcacgtcgcagctgcgtcctggccgcaat
gtgctcgctgtggccgtcagccagtggtctgacggtacattcctcgaagaccaagacatg
tggagaatgtcaggaatcttccgcgaggtcaccttgctggctcggcctcatggcggcatt
gacgaccttttcgtccatgcctcttgggacggtgacgccaagctcctcatcgatgggccg
gagggcgcaaccgtggccatccccgagctcgagctcgccaccacctgcaacaccgaagtg
gcgatccccgacgcgcaaccgtggaccgccgaaacccccaagctctacgacgccacggtc
tccactgataccgaaaccgtcactataaggatcggattccggagtgtcgccattgccgga
gatatcatcaccgtcaacggagaaaaaatcgtattccgtggggttaaccgccacgaatgg
catccacgcaccgggcgaaccctcgatgagcagacgatgcgcgctgacctcgagctcatg
aagcgccacggcgtcaatgccattcgcacctcgcactacccgccgaatgctcgtttcctc
gatctgtgcgatgaatatggcgtctgggtcctcctcgagtgtgacctcgagacccatggc
ttcgagaggggtggttgggacggcaacccgaccaacgacgaccgctggtatgactgccta
cttaaccgcattcaacgcaccgtcgaacgcgacaagaatcatcccgccatcatcgggtgg
tcgatgggcaacgaatcccactgtggcgaaggcattcgccttatgaacgactgggttaag
aatcgtgacccatcccgtttcacccactacgagggggacgacgcccacaccatctgcgat
gtatggacggtcatgtatccgtccatggagtgggtcgaggccgtgcgggaccgcaccgtc
atgcccggggccgagcccgctccgcagacgggacgcgagctcgggctgcccttcttcatg
tgcgagttcgcccatgcgatgggtaatggccccggagaactcgacgcctacgaggagcgc
tgcttcgacccgcacttccaccgtgaccgcatgcatggtggattcatctgggagtggatc
gatcacggcatcgacactggacgtggctatgcctacgggggcgacttcggtgaggtcctg
cacgattcaaacttcgtttgtgatgggctcgtcctgcccgatcgcactccttctccaggc
ctgctggagtttacggcgacgatgggggcggtgcgcatcgaggtcgacggcgagcagctg
cgcgatggcaacggcatcaccgtgatcaaccgacgtgatttctcagacctatccgacctc
acattcgtgtggcagctcgttaacgacgacgagtacgtccagacaggagttctcgaggtc
ggcgccctggccgcccaccaaatctggactgggaccgtgccacttcctgacgagatctcc
gatcggatggttgtcgtcgtggaagcgaagctggtgaaggacaccatctgggcaccggcc
ggtcacgttgtagcccggacatcagctctgctggttcccaagccgggcccccgcctctat
cttccggcatcgtcacagtcgcatcgtgacggtactggctggagtctcggaccagcacac
tttgaccgtcgtggtcgcctcgtgacatggggtaacgcgaacctcgtcgctcctgttctt
gacctcttccgtgcccccattgacaacgatcgggcaagttcactggcccgcaacactatc
ggtgacgcagcactcgcagctggtctcgaccggctcgtccacaccacaacgtcggtgcgc
gacgagggcgatgagttagtcgtcgttactcgcagcgctgctgccgccgcacgcaattcc
atgacgacaacgtggagttggcgcgccatccagaccaatgatggttccgaaggggtgcac
cttgacctccacgtcgatccacacggatactggccgaccatgctcggtcgcattggcgtg
acaatcggcctgcccgcagaatggaccaccgtttcatggtttggcctcgggccgaccgag
aactatcccgattctcagcacgccgccatctggggacgctggaatggagaggtggatgac
ctgcaaaccccctatgtcatgccccaggagaacggccttcgccagggagtccacgaactg
acgatcagcggttcgaacggcggtctgcggatcactgcagacggtagctggccggcattc
gcggcccggccgtggacttcacaggccttgcggactgctgcccatacctgggacctgaag
cccgacgggcacacctggcttaccttggacgccgtgtcagccccgcttggatcgacgtcc
tgcggcccgatgccgatcatgtctcaccgactgtatgctcaaccggttgacctgtcacta
accctgtcgctgatctaa

DBGET integrated database retrieval system