KEGG   Propionibacterium acnes SK137: HMPREF0675_5117Help
Entry
HMPREF0675_5117   CDS       T01215                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pak  Propionibacterium acnes SK137
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pak00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2182303..2183097
Genome map
AA seq 264 aa AA seqDB search
MNTLPGTLHSAHNGTWQVAEHGCQVLAWQADDKPVIWFDAEHADESEAVIRGGIPLCAPW
FGHGPNNDQDPQHGLARRTDFEVTVADPFRVVGVAETASIGIRHEVVMTNTALEMTLTLT
NHDQKPRVVEGMWHTYLRVADAAQARVRGVRGASWHNFATGDKGSFDANELAVAPDTDTV
IQGVGPALALLDSAWGRQIHVETTGCPSAVVWNPRSSSTHADNPTAQAWRDFVCVETGAC
KDNAVIVAPHSDLTMSTRISVETL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccttcctggaacccttcattcggcccataatggcacttggcaggtagcagag
catggctgccaagtgttggcctggcaagccgacgacaagcccgtcatctggttcgacgcc
gagcatgctgacgagtccgaggccgtgatccggggaggaatcccgctgtgtgccccgtgg
tttggtcacggccccaacaatgatcaggacccccagcatggtctagcccgtcgcaccgac
ttcgaagtaacggtcgctgatcccttccgcgttgtcggggttgctgagaccgcgtccatc
ggaatccgtcacgaggttgtcatgacgaacacagccttagaaatgacgcttactctcacc
aaccatgatcagaaaccacgcgtcgtcgaggggatgtggcacacctacctgcgcgtcgca
gatgccgcacaggcacgggtcaggggcgttcgcggcgccagctggcacaacttcgcgacc
ggcgacaaggggtccttcgacgccaacgagcttgccgtagctcctgatactgacaccgtc
atccagggagtcgggcccgccctagccctcctcgattcagcgtggggacgccagatccac
gtggagacaacagggtgtcccagtgccgtggtctggaatccacgctcctcgtcgacacat
gccgataacccgacagcccaggcatggcgcgatttcgtatgcgtcgagaccggggcctgc
aaggacaatgcggtcattgttgccccacacagcgacctcaccatgtccacacggatcagc
gtcgaaacgttgtga

DBGET integrated database retrieval system