KEGG   Propionibacterium acnes SK137: HMPREF0675_5117Help
Entry
HMPREF0675_5117   CDS       T01215                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pak  Propionibacterium acnes SK137
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0675_5117
Enzymes [BR:pak01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     HMPREF0675_5117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2182303..2183097
Genome map
AA seq 264 aa AA seqDB search
MNTLPGTLHSAHNGTWQVAEHGCQVLAWQADDKPVIWFDAEHADESEAVIRGGIPLCAPW
FGHGPNNDQDPQHGLARRTDFEVTVADPFRVVGVAETASIGIRHEVVMTNTALEMTLTLT
NHDQKPRVVEGMWHTYLRVADAAQARVRGVRGASWHNFATGDKGSFDANELAVAPDTDTV
IQGVGPALALLDSAWGRQIHVETTGCPSAVVWNPRSSSTHADNPTAQAWRDFVCVETGAC
KDNAVIVAPHSDLTMSTRISVETL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccttcctggaacccttcattcggcccataatggcacttggcaggtagcagag
catggctgccaagtgttggcctggcaagccgacgacaagcccgtcatctggttcgacgcc
gagcatgctgacgagtccgaggccgtgatccggggaggaatcccgctgtgtgccccgtgg
tttggtcacggccccaacaatgatcaggacccccagcatggtctagcccgtcgcaccgac
ttcgaagtaacggtcgctgatcccttccgcgttgtcggggttgctgagaccgcgtccatc
ggaatccgtcacgaggttgtcatgacgaacacagccttagaaatgacgcttactctcacc
aaccatgatcagaaaccacgcgtcgtcgaggggatgtggcacacctacctgcgcgtcgca
gatgccgcacaggcacgggtcaggggcgttcgcggcgccagctggcacaacttcgcgacc
ggcgacaaggggtccttcgacgccaacgagcttgccgtagctcctgatactgacaccgtc
atccagggagtcgggcccgccctagccctcctcgattcagcgtggggacgccagatccac
gtggagacaacagggtgtcccagtgccgtggtctggaatccacgctcctcgtcgacacat
gccgataacccgacagcccaggcatggcgcgatttcgtatgcgtcgagaccggggcctgc
aaggacaatgcggtcattgttgccccacacagcgacctcaccatgtccacacggatcagc
gtcgaaacgttgtga

DBGET integrated database retrieval system