KEGG   Propionibacterium acnes SK137: HMPREF0675_5146Help
Entry
HMPREF0675_5146   CDS       T01215                                 

Gene name
hemG_2
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pak  Propionibacterium acnes SK137
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0675_5146 (hemG_2)
Enzymes [BR:pak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     HMPREF0675_5146 (hemG_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2205732..2207144
Genome map
AA seq 470 aa AA seqDB search
MVPERAYPQTVSKTVAVIGAGMTGLAAAHHLHSHGCRPVVLEAGQGVGGQVRSRRLGSDV
VDMGPEAVPLRAPGVAALVAELGLTDSMRHPVPGRVLLSSRRGVVEMPSGVTPVGPTKFL
PTIASRILSPAGLLRAGLEPFNAHPHLDDVSVGQFIAERFGDEVSRAVVDPLLGGIHAAD
LNTFSLAVAAPALEQTVRNGDSIVAGTLKRNAAGRWSQLRHHSQRSGPRTPATATWKHGL
MMLPEALARELTIHTNTRARGIRQVGHEWVVDVTGPHGVGSVAVDDVIIATPARVAGALL
ATACPRASELLSQCESTTVATLVMQADLTDHPIATAQTWFIGSAWSALVRQVTNLSTTWH
LAKPTFRIAMGRQRGTPIDDLSDDDLVAMSVAELRRLGLALDPHDYVIERHRGAMPQPAP
GHRERMAQLAATLNGTGLHVGGAGIDGAGVGTAIAAGRRLARHITSKEEN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttggtgccagaacgtgcgtaccctcaaacggtgagcaaaacagtggcagtcatcggtgcc
ggaatgacgggcctggcagccgcacaccacctacacagccacggctgtcgtcccgtcgtc
ctcgaagcggggcagggcgttggcggccaggtcaggtcccgtcgtcttggttctgatgtg
gtcgacatgggacctgaagccgtgcctcttcgcgccccgggcgtcgccgcactcgttgcg
gagctgggactaacggactccatgcgtcatcccgttcctgggcgcgtcttattgtcgagc
cggcgtggagtcgtcgagatgccgtccggcgtaacaccagtagggcccacgaagttcctc
cccactattgcctcgcgcatcctctcccctgccggactgttacgggccgggctcgaacct
ttcaacgctcacccgcaccttgacgacgtcagcgtcggccaattcatcgccgaaagattt
ggtgacgaggtgagccgcgccgtcgtcgacccgctactggggggtattcacgccgccgac
ctcaacacgttctcgctagcagttgccgcccccgctttggagcagacggtcaggaacggc
gactccatcgtcgccggaactctcaaacgcaatgctgccggacggtggtcgcagctccgc
catcattcacagcgatccggtccgcgcacccccgccaccgccacctggaaacacggcctg
atgatgttgccggaagcattggctagggagctcaccattcatacgaatacccgtgccagg
ggaatccgtcaggtcggccacgaatgggtagtcgatgtcactggtccgcatggcgttgga
tcggttgctgttgatgacgtcatcattgccacccccgccagggttgcgggtgccctgctt
gctaccgcatgcccgcgagcttccgagctgctgtcgcagtgtgaaagcactaccgttgcc
acgctggttatgcaggctgaccttactgaccacccgatcgctacggcccaaacgtggttc
attggttcggcatggtctgccctggtgcgtcaagtgaccaatctctcgacgacgtggcac
ctcgccaaacccacctttcggatcgccatgggtcggcagcgtggaacccccatcgacgat
ctatctgacgacgacctcgtcgccatgagcgtggcagagttgagacgtctcggactggct
cttgacccccacgactacgtcattgagcgacaccgcggcgccatgccgcaaccagctcct
ggccaccgggagcgcatggcccagctcgccgcgaccctcaacggcaccggtctccatgtg
ggaggggccggtatcgacggtgccggagttggcaccgcaattgctgctggacgccgtctc
gcacgccacatcacctcgaaggaggagaattag

DBGET integrated database retrieval system