KEGG   Propionibacterium acnes SK137: HMPREF0675_5342Help
Entry
HMPREF0675_5342   CDS       T01215                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pak  Propionibacterium acnes SK137
Pathway
pak00010  Glycolysis / Gluconeogenesis
pak00030  Pentose phosphate pathway
pak00051  Fructose and mannose metabolism
pak00052  Galactose metabolism
pak00680  Methane metabolism
pak01100  Metabolic pathways
pak01110  Biosynthesis of secondary metabolites
pak01120  Microbial metabolism in diverse environments
pak01130  Biosynthesis of antibiotics
pak01200  Carbon metabolism
pak01230  Biosynthesis of amino acids
pak03018  RNA degradation
Module
pak_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0675_5342
   00030 Pentose phosphate pathway
    HMPREF0675_5342
   00051 Fructose and mannose metabolism
    HMPREF0675_5342
   00052 Galactose metabolism
    HMPREF0675_5342
  Energy metabolism
   00680 Methane metabolism
    HMPREF0675_5342
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HMPREF0675_5342
Enzymes [BR:pak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF0675_5342
Protein phosphatases and associated proteins [BR:pak01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF0675_5342
Messenger RNA biogenesis [BR:pak03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HMPREF0675_5342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADE00632
UniProt: D4HBJ1
Position
2388577..2390841
Genome map
AA seq 754 aa AA seqDB search
MHVDDEMRLTPTLPDGHGLRIGILTSGGDAQGMNAAVRAVVRSALSVGAEVYAIYEGYQG
MIDGGDGIRRFGWDDVGSILNRGGTVIGTFRCKGMRERPGRLKAVRNLLEHGIDRLVVIG
GDGSLTGLDVLRTEWTDLVAELVDTGQVSAEVAREHPALMIAGLVGSIDNDLVGSDMTIG
ADTALHRIVDAIDDLASTAASHQRSFVVEVMGRHCGYLALMAAVAGGADYVLIPERPPED
GWEDRMCAELKRGRQAGRRDSIVVVAEGATDRSGNRISSEYVRQVLEDKLGEDARVTILG
HVQRGGRPSAYDRWASTWLGYHAVHEVLSTTPEAEGRVIGTGSNRIHRLPLVKAVADTKS
VPGLITEGRYNEAMRMRGRSFVEMDAIFTELSEPARTTSDTAGDADRKRVAIMHAGGPAP
GMNTAARAAVRLAISRGHTVVGIHNGFIGLATGDMSELAWSDVEGWAGEGGAELGTRREI
PSTRDLYAVSRALEDHHIDALLVIGGYSAYEGIYTMMTERDRYPAFRIPTVCIPASIDNN
LPGSELSIGTDTALNVIVEAMDKIKESGIASRRCFVVETMGRDCGYLALMSGIAAGAERI
YTNEDGISLDDLANDVHWLRESFAHGRRLFLAVRNENASHNYTTDFIARLLEEESHGMYD
VRQVVLGHMQQGGSPSPFDRLLANRLGYRALNLIDDELAAHQDGSWFIGVNESGMRPCSM
DTMPSLIDAAHRRPREQWWLQLRTIARMVSDEVR
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgttgatgacgagatgaggctcacccccactctccccgacggtcatggtctgcgc
attggcatcctgaccagcggtggcgacgctcagggcatgaacgctgctgtgcgggctgtg
gtgcgctctgcgctaagtgtgggagccgaggtctatgcgatatacgagggctaccaggga
atgatcgatggtggcgatggcatccgtaggttcgggtgggacgacgtcggctcgatcctc
aaccgtggcggcaccgtgatcggaaccttccgttgcaaggggatgcgcgaacgtccgggg
cgcctgaaggctgtcagaaatctcctcgaacacgggatcgatcgtctcgtcgtcatcggc
ggtgacggttcgctcaccggcctggatgtgctgcgcaccgaatggacagacctggtcgct
gaactcgtcgacaccggccaggtgagcgccgaggtagcccgggaacaccccgccctcatg
atcgccgggctcgtcggatccatcgacaatgacctcgtcggatccgatatgaccatcggt
gccgatactgctctgcaccgtattgtcgatgccatcgacgacctcgcctccaccgcggcc
agccaccagcgatccttcgtcgttgaggtgatgggccgccactgcggctatctcgccctt
atggcagcagttgccggcggagctgactatgttcttattccggaacggccgcccgaggac
ggttgggaggaccgcatgtgcgccgagctcaaacgtggccgtcaggcgggccgacgcgac
tcgatcgtcgtcgtcgcggagggcgccaccgatcgttccgggaaccggatctcctcggag
tacgtccgccaggtgcttgaggacaaactcggtgaggacgcccgggttaccatcctgggc
cacgtccagcgcggcggacgaccgtcagcctatgaccgctgggcgtcgacctggttgggt
tatcacgcggttcacgaggtgctctcgaccactccagaggccgaggggcgcgttatcggc
actgggtccaaccgcatacatcgcctccccctggtcaaggccgtcgctgacacgaagtcg
gtgcccggtctcattacggagggccgttacaacgaggccatgcggatgaggggacgttcc
tttgtcgagatggacgcgatcttcaccgaactcagtgaaccagctcgtaccacttccgac
accgctggtgacgccgaccgcaagcgcgtcgcgatcatgcacgctggcggtccggccccg
ggcatgaatactgctgcccgtgctgcagtgcgactggcgatttcccgcggtcataccgtt
gtgggaatccataacgggttcatcggactagcgaccggggacatgtcggaattggcctgg
agcgacgtcgagggctgggccggggaaggcggcgctgagctgggtacccgccgcgagatc
cctagcactcgcgacctttatgctgtcagccgcgctctggaggatcatcacatcgacgcg
ttgctcgtcattggtggctactcggcctacgaaggtatctacaccatgatgactgagcgg
gaccggtacccggctttccgtattccgacggtgtgcattccggcttcgatcgacaacaac
ctccccggttcggaactgtccatcggcaccgacaccgctctcaacgtcattgtcgaggcg
atggacaagattaaagagtcgggtatcgcgtccagacgctgcttcgtcgtcgagacgatg
ggtcgtgactgcggatacctcgcgctgatgtcgggtatcgcagctggcgctgagcggatc
tataccaacgaggacggcatctccctggacgatctagccaacgacgtccattggttgcgg
gagtcattcgcccacggacgacgacttttccttgccgtgcgcaacgagaacgcatcgcac
aattacaccaccgacttcatcgcgcggctgctggaggaggaatcacacggcatgtatgac
gtacgccaggtggtactagggcatatgcagcaaggcggctcaccctcacctttcgaccgc
ttgctcgccaaccgactcgggtatcgcgctctcaatctcattgacgacgagttggcggcg
catcaggacggttcatggttcattggcgtcaacgagtcgggcatgcggccctgttcgatg
gacaccatgccctctctcattgacgccgctcatcgtcgtccccgcgaacagtggtggctg
caactgaggactattgccaggatggtctcggacgaggtgcggtaa

DBGET integrated database retrieval system